Honoris.net
Honoris United Universities - The 1st Pan-African private higher education network
Domain Summary
What is the traffic rank for Honoris.net?
• Honoris.net ranks #4,650,138 globally on HypeStat.
What percent of global Internet users visit Honoris.net?
• 1.61E-5% of global Internet users visit Honoris.net
How many people visit Honoris.net each day?
• Honoris.net receives approximately 793 visitors and 312 page impressions per day.
How much Honoris.net can earn?
• Honoris.net should earn about $1.27/day from advertising revenue.
What is Honoris.net estimated value?
• Estimated value of Honoris.net is $1,137.47.
What IP addresses does Honoris.net resolve to?
• Honoris.net resolves to the IP addresses 91.121.210.45.
Where are Honoris.net servers located in?
• Honoris.net has servers located in France.
honoris.net Profile
Title:Honoris United Universities - The 1st Pan-African private higher education network
Description:The 1st Pan-African private higher education network
Category:Science and Education / Education
What technologies does honoris.net use?
These are the technologies used at honoris.net. honoris.net has a total of 18 technologies installed in 16 different categories.
honoris.net Traffic Analysis
Honoris.net is ranked #4,650,138 in the world. This website is viewed by an estimated 793 visitors daily, generating a total of 312 pageviews. This equates to about 24K monthly visitors. Honoris.net traffic has decreased by 81.33% compared to last month.Daily Visitors793
83.33%
Monthly Visits24K
81.33%
Pages per Visit0.39
78.43%
Visit duration00:34
4500%
Bounce Rate65.68%
72.43%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 793
- Monthly Visits:
- 24,028
- Pages per Visit:
- 0.39
- Daily Pageviews:
- 312
- Avg. visit duration:
- 00:34
- Bounce rate:
- 65.68%
- Global Reach:
- 1.61E-5%
- Monthly Visits (SEMrush):
- 1,168
- Monthly Unique Visitors (SEMrush):
- 1,043
- Monthly Visits (SimilarWeb):
- 23,560
- HypeRank:
- 4,650,138
- SEMrush Rank:
- 5,106,232
- SimilarWeb Rank:
- 3,094,676
Traffic sources
- Direct:
- 12.16%
- Referral:
- 0%
- Search:
- 87.84%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 100.00%
- Mobile:
- 0%
Total Visits Last 3 Months
21.2K
MAR
128.7K
APR
24K
MAY
Backlinks Report ▼
Honoris.net has a total of 3,736 backlinks from 735 referring domains and most of them comes from United States.- Total Backlinks:
- 3,736
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 735
- Referring IPs:
- 764
- Authority Domain Score:
- 28
Backlinks by country
- Country
- Domains
- United States 340
- France 57
- Germany 39
- Netherlands 24
- Singapore 24
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 375
- .org
- 38
- .net
- 31
- .edu
- 0
- .gov
- 0
Which sites are competitors to honoris.net?
Websites similar to honoris.net are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 374 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with honoris.net in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Bing Index:
- 829
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- honoris.net
- Rank:
(Rank based on keywords, cost and organic traffic) - 5,106,232
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 143
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 32
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $1.00
Revenue report ▼
Google.com would generate approximately $1.3 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $38.1 and annual gross revenue of approximately $463.6. Based on these figures, the site's net worth is estimated at around $1.1K.How much would honoris.net make?
- Daily Revenue:
- $1.27
- Monthly Revenue:
- $38.10
- Yearly Revenue:
- $463.55
How much is honoris.net worth?
- Website Value:
- $1.1K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- honoris.net
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- honoris.net
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- honoris.net
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is honoris.net hosted? ▼
Honoris.net may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 91.121.210.45
- ASN:
- AS16276
- ISP:
- OVH SAS
- Server Location:
France, FR
Other sites hosted on 91.121.210.45
There are no other sites hosted on this IPHow fast does honoris.net load? ▼
The average loading time of honoris.net is 634 ms.- Average Load Time:
- 634 ms
Does honoris.net use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on honoris.net are reduced by 82%.
honoris.net use gzip compression.
Original size: 435.81 KB
Compressed size: 77.05 KB
File reduced by: 358.76 KB (82%)
Compressed size: 77.05 KB
File reduced by: 358.76 KB (82%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. honoris.net supports HTTPS. honoris.net supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.honoris.net
Organization:
Location:
Issuer: Sectigo RSA Domain Validation Secure Server CA
Valid from: Aug 26 00:00:00 2022 GMT
Valid until: Aug 26 23:59:59 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: Sectigo RSA Domain Validation Secure Server CA
Valid from: Aug 26 00:00:00 2022 GMT
Valid until: Aug 26 23:59:59 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: USERTrust RSA Certification Authority
Organization: The USERTRUST Network
Location: Jersey City, New Jersey, US
Issuer: AAA Certificate Services
Valid from: Mar 12 00:00:00 2019 GMT
Valid until: Dec 31 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: The USERTRUST Network
Location: Jersey City, New Jersey, US
Issuer: AAA Certificate Services
Valid from: Mar 12 00:00:00 2019 GMT
Valid until: Dec 31 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Common Name: Sectigo RSA Domain Validation Secure Server CA
Organization: Sectigo Limited
Location: Salford, Greater Manchester, GB
Issuer: USERTrust RSA Certification Authority
Valid from: Nov 2 00:00:00 2018 GMT
Valid until: Dec 31 23:59:59 2030 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Sectigo Limited
Location: Salford, Greater Manchester, GB
Issuer: USERTrust RSA Certification Authority
Valid from: Nov 2 00:00:00 2018 GMT
Valid until: Dec 31 23:59:59 2030 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: AAA Certificate Services
Organization: Comodo CA Limited
Location: Salford, Greater Manchester, GB
Issuer: AAA Certificate Services
Valid from: Jan 1 00:00:00 2004 GMT
Valid until: Dec 31 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Comodo CA Limited
Location: Salford, Greater Manchester, GB
Issuer: AAA Certificate Services
Valid from: Jan 1 00:00:00 2004 GMT
Valid until: Dec 31 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. honoris.net does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Date: Tue, 13 Jun 2023 12:07:05 GMT
Server: Pluff_HTTP_Server
X-Frame-Options: SAMEORIGIN
X-Powered-By: PHP/7.4.33
Cache-Control: no-cache
X-Nitro-Cache: HIT
X-Nitro-Cache-From: drop-in
vary: user-agent
x-nitro-rev: 670cd66
link: <https://cdn-flbag.nitrocdn.com>; rel=preconnect
link: <https://honoris.net/wp-json/>; rel="https://api.w.org/"
link: <https://honoris.net/wp-json/wp/v2/pages/5749>; rel="alternate"; type="application/json"
link: <https://honoris.net/>; rel=shortlink
x-frame-options: SAMEORIGIN
x-xss-protection: 1; mode=block
x-cache-ctime: 1686598665
content-encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| TXT | 3600 | ||
| TXT | 3600 | ||
| TXT | 3600 | ||
| MX | 3600 | ||
| SOA | 600 | ||
| Mname | ns27.domaincontrol.com | ||
| Rname | dns.jomax.net | ||
| Serial Number | 2022102400 | ||
| Refresh | 28800 | ||
| Retry | 7200 | ||
| Expire | 604800 | ||
| Minimum TTL | 600 | ||
| A | 91.121.210.45 | 524 | |
| NS | 3524 | ||
| NS | 3524 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on November 21, 2007 and will expire on November 21, 2027 if not renewed. This website is now assigned through the registrar GoDaddy.com, LLC. The WHOIS data for this website's domain was last updated on November 16, 2022.- Domain Created:
- 2007-11-21
- Domain Expires:
- 2027-11-21
- Domain Updated:
- 2022-11-16
- Domain Age:
- 16 years 7 months
- Domain Registrar:
- GoDaddy.com, LLC
- Domain Owner:
- Domains By Proxy, LLC
- WhoIs:
Domain Name: honoris.net Registry Domain ID: 1338363729_DOMAIN_NET-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: https://www.godaddy.com Updated Date: 2022-11-16T08:34:27Z Creation Date: 2007-11-21T12:31:39Z Registrar Registration Expiration Date: 2027-11-21T12:31:39Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Registrant Street: DomainsByProxy.com Registrant Street: 2155 E Warner Rd Registrant City: Tempe Registrant State/Province: Arizona Registrant Postal Code: 85284 Registrant Country: US Registrant Phone: +1.4806242599 Registrant Phone Ext: Registrant Fax: +1.4806242598 Registrant Fax Ext: Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=honoris.net Registry Admin ID: Not Available From Registry Admin Name: Registration Private Admin Organization: Domains By Proxy, LLC Admin Street: DomainsByProxy.com Admin Street: 2155 E Warner Rd Admin City: Tempe Admin State/Province: Arizona Admin Postal Code: 85284 Admin Country: US Admin Phone: +1.4806242599 Admin Phone Ext: Admin Fax: +1.4806242598 Admin Fax Ext: Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=honoris.net Registry Tech ID: Not Available From Registry Tech Name: Registration Private Tech Organization: Domains By Proxy, LLC Tech Street: DomainsByProxy.com Tech Street: 2155 E Warner Rd Tech City: Tempe Tech State/Province: Arizona Tech Postal Code: 85284 Tech Country: US Tech Phone: +1.4806242599 Tech Phone Ext: Tech Fax: +1.4806242598 Tech Fax Ext: Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=honoris.net Name Server: NS27.DOMAINCONTROL.COM Name Server: NS28.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-06-13T12:08:18Z