Inscription.ma
Concours au Maroc, Resultats, Exemple Examens - inscription.maDomain Summary
What is the traffic rank for Inscription.ma?
• Inscription.ma ranks #3,233,594 globally on HypeStat.
What percent of global Internet users visit Inscription.ma?
• 5.01E-5% of global Internet users visit Inscription.ma
How many people visit Inscription.ma each day?
• Inscription.ma receives approximately 2.5K visitors and 7,424 page impressions per day.
Which countries does Inscription.ma receive most of its visitors from?
• Inscription.ma is mostly visited by people located in Morocco,Spain,Netherlands.
How much Inscription.ma can earn?
• Inscription.ma should earn about $4.66/day from advertising revenue.
What is Inscription.ma estimated value?
• Estimated value of Inscription.ma is $4,530.00.
What IP addresses does Inscription.ma resolve to?
• Inscription.ma resolves to the IP addresses 168.119.167.219.
Where are Inscription.ma servers located in?
• Inscription.ma has servers located in Germany.
inscription.ma Profile
Title:Concours au Maroc, Resultats, Exemple Examens - inscription.ma
Description:espace étudiants الاطلاع على النقط دروس و تمارين امتحانات فروض العطل التوجيه après le bac دليل المدارس مباريات المدارس نماذج المباريات التكوين المهني باك حر الدراسة بالخارج espace professeurs جذاذات استعمال الزمن التوزيع السنوي التقويم التشخيصي
Category:Science and Education / Education
About:
Inscription.ma is an online platform that provides a range of services related to the inscription of documents. It allows users to register documents, such as birth certificates, marriage certificates, and death certificates, with the Moroccan government. The platform also provides a range of other services, such as document authentication, document legalization, and document translation. Inscription.ma is a secure and reliable platform that makes it easy for users to register documents with the Moroccan government.
*This text is generated by artificial intelligence and may not be accurate. Edit Site Info
What technologies does inscription.ma use?
These are the technologies used at inscription.ma. inscription.ma has a total of 8 technologies installed in 9 different categories.inscription.ma Traffic Analysis
Inscription.ma is ranked #3,233,594 in the world. This website is viewed by an estimated 2.5K visitors daily, generating a total of 7.4K pageviews. This equates to about 74.8K monthly visitors. Inscription.ma traffic has increased by 36.57% compared to last month.Daily Visitors2.5K
26.11%
Monthly Visits74.8K
36.57%
Pages per Visit3.01
76.61%
Visit duration02:39
23.62%
Bounce Rate38.97%
33.76%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 2,469
- Monthly Visits:
- 74,811
- Pages per Visit:
- 3.01
- Daily Pageviews:
- 7,424
- Avg. visit duration:
- 02:39
- Bounce rate:
- 38.97%
- Global Reach:
- 5.01E-5%
- Monthly Visits (SEMrush):
- 26,813
- Monthly Unique Visitors (SEMrush):
- 23,945
- Monthly Visits (SimilarWeb):
- 73,348
- HypeRank:
- 3,233,594
- SEMrush Rank:
- 8,570,818
- SimilarWeb Rank:
- 610,719
Traffic sources
- Direct:
- 25.39%
- Referral:
- 21.42%
- Search:
- 53.19%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 38.73%
- Mobile:
- 61.27%
Total Visits Last 3 Months
76.4K
JAN
54.8K
FEB
74.8K
MAR
Visitors by country
- Country
- Users%
- Morocco 91.84%
- Spain 3.82%
- Netherlands 1.26%
- Italy 1.25%
- Belgium 1.21%
Where do visitors go on inscription.ma?
- Reach%Pageviews%PerUser
- inscription.ma
- 100.00%100.00%2
Backlinks Report ▼
Inscription.ma has a total of 2,424 backlinks from 396 referring domains and most of them comes from United States.- Total Backlinks:
- 2,424
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 396
- Referring IPs:
- 261
- Authority Domain Score:
- 15
Backlinks by country
- Country
- Domains
- United States 164
- Singapore 143
- Germany 17
- Netherlands 12
- France 10
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 162
- .pw
- 65
- .in
- 41
- .edu
- 1
- .gov
- 0
Which sites are competitors to inscription.ma?
Websites similar to inscription.ma are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 412 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with inscription.ma in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- inscription.ma
- Rank:
(Rank based on keywords, cost and organic traffic) - 8,570,818
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 29
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 5
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $4.7 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $139.8 and annual gross revenue of approximately $1.7K. Based on these figures, the site's net worth is estimated at around $4.5K.How much would inscription.ma make?
- Daily Revenue:
- $4.66
- Monthly Revenue:
- $139.80
- Yearly Revenue:
- $1,700.90
Daily earning by country
- CountryPageviewsEarning
- Morocco 6,819$4.09
- Netherlands 94$0.18
- Spain 284$0.14
- Belgium 90$0.05
- Italy 93$0.02
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.15
- Monthly Revenue Loss:
- $4.44
- Yearly Revenue Loss:
- $53.98
- Daily Pageviews Blocked:
- 233
- Monthly Pageviews Blocked:
- 6,985
- Yearly Pageviews Blocked:
- 84,989
Daily revenue loss by country
- CountryBlockedLost Money
- Morocco 136$0.08
- Netherlands 16$0.03
- Spain 54$0.03
- Belgium 11$0.01
- Italy 16$0.00
How much is inscription.ma worth?
- Website Value:
- $4.5K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- inscription.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- inscription.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- inscription.ma
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is inscription.ma hosted? ▼
Inscription.ma may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 168.119.167.219
- ASN:
- AS24940
- ISP:
- Hetzner Online GmbH
- Server Location:
Germany, DE
Other sites hosted on 168.119.167.219
How fast does inscription.ma load? ▼
The average loading time of inscription.ma is 427 ms. The Desktop speed index is 96 and mobile speed index is 60.- Average Load Time:
- 427 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a AVERAGE speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)2.1s
First Input Delay (FID)3ms
Origin Data
All pages served from this origin have an AVERAGE speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)2.1s
First Input Delay (FID)3ms
Lab Data
Max Potential First Input Delay 100 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more
First Meaningful Paint 0.5 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more
First Meaningful Paint measures when the primary content of a page is visible. Learn more
Largest Contentful Paint 0.7 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more
Avoids `unload` event listeners
The `unload` event does not fire reliably and listening for it can prevent browser optimizations like the Back-Forward Cache. Use `pagehide` or `visibilitychange` events instead. Learn more
The `unload` event does not fire reliably and listening for it can prevent browser optimizations like the Back-Forward Cache. Use `pagehide` or `visibilitychange` events instead. Learn more
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more
Speed Index 1.7 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more
Speed Index shows how quickly the contents of a page are visibly populated. Learn more
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more
Time to Interactive 1.8 s
Time to interactive is the amount of time it takes for the page to become fully interactive. Learn more
Time to interactive is the amount of time it takes for the page to become fully interactive. Learn more
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn more
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn more
Total Blocking Time 90 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more
First Contentful Paint 0.3 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more
First Contentful Paint marks the time at which the first text or image is painted. Learn more
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a AVERAGE speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)1.9s
First Input Delay (FID)22ms
Origin Data
All pages served from this origin have an AVERAGE speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)1.9s
First Input Delay (FID)22ms
Lab Data
Max Potential First Input Delay 360 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more
Time to Interactive 8.4 s
Time to interactive is the amount of time it takes for the page to become fully interactive. Learn more
Time to interactive is the amount of time it takes for the page to become fully interactive. Learn more
First Contentful Paint 1.3 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more
First Contentful Paint marks the time at which the first text or image is painted. Learn more
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn more
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn more
Total Blocking Time 1,180 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more
Speed Index 7.0 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more
Speed Index shows how quickly the contents of a page are visibly populated. Learn more
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more
Largest Contentful Paint 2.6 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more
Avoids `unload` event listeners
The `unload` event does not fire reliably and listening for it can prevent browser optimizations like the Back-Forward Cache. Use `pagehide` or `visibilitychange` events instead. Learn more
The `unload` event does not fire reliably and listening for it can prevent browser optimizations like the Back-Forward Cache. Use `pagehide` or `visibilitychange` events instead. Learn more
First Meaningful Paint 2.0 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more
First Meaningful Paint measures when the primary content of a page is visible. Learn more
First Contentful Paint (3G) 2806 ms
First Contentful Paint 3G marks the time at which the first text or image is painted while on a 3G network. Learn more
First Contentful Paint 3G marks the time at which the first text or image is painted while on a 3G network. Learn more
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more
Does inscription.ma use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on inscription.ma are reduced by 78%.
inscription.ma use gzip compression.
Original size: 21.39 KB
Compressed size: 4.61 KB
File reduced by: 16.78 KB (78%)
Compressed size: 4.61 KB
File reduced by: 16.78 KB (78%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. inscription.ma supports HTTPS. inscription.ma supports HTTPS
Verifying SSL Support. Please wait...
Common Name: inscription.ma
Organization:
Location:
Issuer: R3
Valid from: Apr 1 21:00:37 2023 GMT
Valid until: Jun 30 21:00:36 2023 GMT
Authority: CA:FALSE
Keysize:
Organization:
Location:
Issuer: R3
Valid from: Apr 1 21:00:37 2023 GMT
Valid until: Jun 30 21:00:36 2023 GMT
Authority: CA:FALSE
Keysize:
Common Name: R3
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: ISRG Root X1
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. inscription.ma supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.x-dns-prefetch-control: on
content-type: text/html; charset=UTF-8
x-ua-compatible: IE=edge
vary: Accept-Encoding
server: LiteSpeed
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
x-litespeed-cache: hit
content-encoding: gzip
content-length: 4719
date: Fri, 07 Apr 2023 21:04:29 GMT
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 3524 | ||
Mname | ns1.mhamzou.com | ||
Rname | hostmaster.inscription.ma | ||
Serial Number | 2020102801 | ||
Refresh | 3600 | ||
Retry | 1800 | ||
Expire | 1209600 | ||
Minimum TTL | 86400 | ||
TXT | 3524 | ||
MX | 3524 | ||
A | 168.119.167.219 | 3520 | |
NS | 3520 | ||
NS | 3520 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on November 13, 2017 and will expire on November 13, 2026 if not renewed. This website is now assigned through the registrar NAJA7HOST. The WHOIS data for this website's domain was last updated on March 21, 2023.- Domain Created:
- 2017-11-13
- Domain Expires:
- 2026-11-13
- Domain Updated:
- 2023-03-21
- Domain Age:
- 6 years 6 months 11 days
- Domain Registrar:
- NAJA7HOST
- Domain Owner:
- Zakariae Mhamzou
- WhoIs:
Domain Name: inscription.ma Updated Date: 2023-03-21T15:36:32.843Z Creation Date: 2017-11-13T15:31:18.453Z Registry Expiry Date: 2026-11-13T15:31:18.534Z Sponsoring Registrar: NAJA7HOST Domain Status: clientTransferProhibited Domain Status: ok Registrant Name: Zakariae Mhamzou Admin Name: Zakariae Mhamzou Admin Phone: +212.674675984 Admin Phone Ext: Admin Email: Tech Name: Zakariae Mhamzou Tech Phone: +212.674675984 Tech Phone Ext: Tech Email: Name Server: ns1.mhamzou.com Name Server: ns2.mhamzou.com >>> Last update of WHOIS database: 2023-04-07T21:04:03.689Z