Capres.ca
Observatoire sur la réussite en enseignement supérieur | ORESDomain Summary
What is the traffic rank for Capres.ca?
• Capres.ca ranks #5,996,175 globally on HypeStat.
What percent of global Internet users visit Capres.ca?
• 1.0E-7% of global Internet users visit Capres.ca
How many people visit Capres.ca each day?
• Capres.ca receives approximately 5 visitors and 44 page impressions per day.
How much Capres.ca can earn?
• Capres.ca should earn about $0.18/day from advertising revenue.
What is Capres.ca estimated value?
• Estimated value of Capres.ca is $168.33.
What IP addresses does Capres.ca resolve to?
• Capres.ca resolves to the IP addresses 15.197.142.173.
Where are Capres.ca servers located in?
• Capres.ca has servers located in United States.
capres.ca Profile
Title:Observatoire sur la réussite en enseignement supérieur | ORES
Description:L'ORES est la référence sur les enjeux de réussite en enseignement collégial et universitaire. Retrouvez les données les plus récentes et des outils pratiques.
Category:Science and Education / Education
What technologies does capres.ca use?
These are the technologies used at capres.ca. capres.ca has a total of 10 technologies installed in 11 different categories.capres.ca Traffic Analysis
Capres.ca is ranked #5,996,175 in the world. This website is viewed by an estimated 5 visitors daily, generating a total of 44 pageviews. This equates to about 151.5 monthly visitors.Daily Visitors5
Monthly Visits151.5
Pages per Visit8.46
Visit duration03:01
Bounce Rate1.00%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 5
- Monthly Visits:
- 152
- Pages per Visit:
- 8.46
- Daily Pageviews:
- 44
- Avg. visit duration:
- 03:01
- Bounce rate:
- 1.00%
- Global Reach:
- 1.0E-7%
- Monthly Visits (SimilarWeb):
- 153
- HypeRank:
- 5,996,175
- SimilarWeb Rank:
- 12,646,586
Total Visits Last 3 Months
0.9K
JUN
151.5
JUL
151.5
AUG
Backlinks Report ▼
Capres.ca has a total of 583 backlinks from 83 referring domains and most of them comes from United States.- Total Backlinks:
- 583
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 83
- Referring IPs:
- 65
- Authority Domain Score:
- 6
Backlinks by country
- Country
- Domains
- United States 53
- Canada 4
- Italy 4
- Austria 3
- Indonesia 2
Backlinks by TLDs
- TLD Distribution
- Domains
- .pw
- 26
- .com
- 25
- .dev
- 5
- .edu
- 0
- .gov
- 0
Which sites are competitors to capres.ca?
Websites similar to capres.ca are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
Last update was 270 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with capres.ca in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Bing Index:
- 1,200
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- capres.ca
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $0.2 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $5.4 and annual gross revenue of approximately $65.7. Based on these figures, the site's net worth is estimated at around $168.3.How much would capres.ca make?
- Daily Revenue:
- $0.18
- Monthly Revenue:
- $5.40
- Yearly Revenue:
- $65.70
How much is capres.ca worth?
- Website Value:
- $168.3
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- capres.ca
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- capres.ca
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- capres.ca
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is capres.ca hosted? ▼
Capres.ca may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 15.197.142.173
- ASN:
- AS16509
- ISP:
- Amazon.com, Inc.
- Server Location:
United States, US
Other sites hosted on 15.197.142.173
How fast does capres.ca load? ▼
The average loading time of capres.ca is 175 ms.- Average Load Time:
- 175 ms
Does capres.ca use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on capres.ca are reduced by 78%.
capres.ca use br compression.
Original size: 56.99 KB
Compressed size: 12.44 KB
File reduced by: 44.55 KB (78%)
Compressed size: 12.44 KB
File reduced by: 44.55 KB (78%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. capres.ca supports HTTPS. capres.ca supports HTTPS
Verifying SSL Support. Please wait...
Common Name: oresquebec.ca
Organization:
Location:
Issuer: GTS CA 1P5
Valid from: Sep 12 08:54:57 2023 GMT
Valid until: Dec 11 08:54:56 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: GTS CA 1P5
Valid from: Sep 12 08:54:57 2023 GMT
Valid until: Dec 11 08:54:56 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: GTS CA 1P5
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: GTS Root R1
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. capres.ca supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Date: Sun, 24 Sep 2023 14:34:09 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 60
Connection: keep-alive
Location: https://www.oresquebec.ca
Server: ip-10-123-122-139.ec2.internal
X-Request-Id: 58c395de-62c5-4a5b-9459-3b5aaab7de5b
HTTP/2 200
date: Sun, 24 Sep 2023 14:34:09 GMT
content-type: text/html; charset=UTF-8
vary: Accept-Encoding
x-cache: HIT
x-cache-hits: 2
cf-cache-status: DYNAMIC
report-to: {"endpoints":[{"url":"https://a.nel.cloudflare.com/report/v3?s=Duf8162BiwJ0JRXcFgCpy8fIlZiOrl0NgTCN9Y25imWKu7ei1E1wc%2B%2F7R6wAx1CJw90i8XIJgXrE8BawqPa181WDk%2Bq4m0ndAV3hUqcw%2FVC8IMajc5t5NS%2Fs8Fr5VFaMARElFw%3D%3D"}],"group":"cf-nel","max_age":604800}
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
cf-ray: 80bbbf203c3e1133-ORD
content-encoding: br
alt-svc: h3=":443"; ma=86400
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
TXT | 600 | ||
TXT | 600 | ||
MX | 600 | ||
SOA | 3600 | ||
Mname | ns57.domaincontrol.com | ||
Rname | dns.jomax.net | ||
Serial Number | 2023031400 | ||
Refresh | 28800 | ||
Retry | 7200 | ||
Expire | 604800 | ||
Minimum TTL | 600 | ||
A | 3.33.152.147 | 524 | |
A | 15.197.142.173 | 524 | |
NS | 3600 | ||
NS | 3600 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on July 21, 2014 and will expire on July 21, 2024 if not renewed. This website is now assigned through the registrar Go Daddy Domains Canada, Inc. The WHOIS data for this website's domain was last updated on June 12, 2023.- Domain Created:
- 2014-07-21
- Domain Expires:
- 2024-07-21
- Domain Updated:
- 2023-06-12
- Domain Age:
- 9 years 11 months
- Domain Registrar:
- Go Daddy Domains Canada, Inc
- Domain Owner:
- REDACTED FOR PRIVACY
- WhoIs:
Domain Name: capres.ca Registry Domain ID: 17615279-CIRA Registrar WHOIS Server: whois.ca.fury.ca Registrar URL: ca.godaddy.com Updated Date: 2023-06-12T13:32:22Z Creation Date: 2014-07-21T19:28:47Z Registry Expiry Date: 2024-07-21T19:28:47Z Registrar: Go Daddy Domains Canada, Inc Registrar IANA ID: not applicable Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Registry Registrant ID: REDACTED FOR PRIVACY Registrant Name: REDACTED FOR PRIVACY Registrant Organization: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant City: REDACTED FOR PRIVACY Registrant State/Province: REDACTED FOR PRIVACY Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: REDACTED FOR PRIVACY Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: REDACTED FOR PRIVACY Registrant Fax: REDACTED FOR PRIVACY Registrant Fax Ext: REDACTED FOR PRIVACY Registrant Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name Registry Admin ID: REDACTED FOR PRIVACY Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: REDACTED FOR PRIVACY Admin Fax: REDACTED FOR PRIVACY Admin Fax Ext: REDACTED FOR PRIVACY Admin Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name Registry Tech ID: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: REDACTED FOR PRIVACY Tech Fax: REDACTED FOR PRIVACY Tech Fax Ext: REDACTED FOR PRIVACY Tech Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name Registry Billing ID: REDACTED FOR PRIVACY Billing Name: REDACTED FOR PRIVACY Billing Organization: REDACTED FOR PRIVACY Billing Street: REDACTED FOR PRIVACY Billing City: REDACTED FOR PRIVACY Billing State/Province: REDACTED FOR PRIVACY Billing Postal Code: REDACTED FOR PRIVACY Billing Country: REDACTED FOR PRIVACY Billing Phone: REDACTED FOR PRIVACY Billing Phone Ext: REDACTED FOR PRIVACY Billing Fax: REDACTED FOR PRIVACY Billing Fax Ext: REDACTED FOR PRIVACY Billing Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name Name Server: ns57.domaincontrol.com Name Server: ns58.domaincontrol.com DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-09-24T14:35:17Z