Eigsica.ma
Ecole Ingénieurs Casablanca Maroc | EIGSIDomain Summary
What is the traffic rank for Eigsica.ma?
• Eigsica.ma ranks #5,033,610 globally on HypeStat.
What percent of global Internet users visit Eigsica.ma?
• 1.52E-5% of global Internet users visit Eigsica.ma
How many people visit Eigsica.ma each day?
• Eigsica.ma receives approximately 750 visitors and 298 page impressions per day.
Which countries does Eigsica.ma receive most of its visitors from?
• Eigsica.ma is mostly visited by people located in Morocco,Turkey,Senegal.
How much Eigsica.ma can earn?
• Eigsica.ma should earn about $0.96/day from advertising revenue.
What is Eigsica.ma estimated value?
• Estimated value of Eigsica.ma is $860.81.
What IP addresses does Eigsica.ma resolve to?
• Eigsica.ma resolves to the IP addresses 95.142.172.156.
Where are Eigsica.ma servers located in?
• Eigsica.ma has servers located in France.
eigsica.ma Profile
Title:Ecole Ingénieurs Casablanca Maroc | EIGSI
Description:Ecole Ingénieurs Casablanca Maroc | Grande Ecole française d'Ingénieurs à Casablanca, l'EIGSI délivre un diplôme français d'ingénieurs reconnu au Maroc.
Category:Science and Education / Education
What technologies does eigsica.ma use?
These are the technologies used at eigsica.ma. eigsica.ma has a total of 13 technologies installed in 11 different categories.eigsica.ma Traffic Analysis
Eigsica.ma is ranked #5,033,610 in the world. This website is viewed by an estimated 750 visitors daily, generating a total of 298 pageviews. This equates to about 22.7K monthly visitors. Eigsica.ma traffic has increased by 32.23% compared to last month.Daily Visitors750
15.2%
Monthly Visits22.7K
32.23%
Pages per Visit0.40
102.14%
Visit duration01:26
741.46%
Bounce Rate69.94%
70.08%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 750
- Monthly Visits:
- 22,725
- Pages per Visit:
- 0.40
- Daily Pageviews:
- 298
- Avg. visit duration:
- 01:26
- Bounce rate:
- 69.94%
- Global Reach:
- 1.52E-5%
- Monthly Visits (SEMrush):
- 3,639
- Monthly Unique Visitors (SEMrush):
- 2,265
- Monthly Visits (SimilarWeb):
- 22,288
- HypeRank:
- 5,033,610
- SEMrush Rank:
- 25,162,590
- SimilarWeb Rank:
- 3,580,843
Traffic sources
- Direct:
- 37.76%
- Referral:
- 37.76%
- Search:
- 24.48%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 100.00%
- Mobile:
- 0%
Total Visits Last 3 Months
14.2K
JUL
17.2K
AUG
22.7K
SEP
Visitors by country
- Country
- Users%
- Morocco 8.49%
- Turkey 6.67%
- Senegal 6.42%
- United States 6.09%
- Mexico 5.82%
Backlinks Report ▼
Eigsica.ma has a total of 164 backlinks from 44 referring domains and most of them comes from Singapore.- Total Backlinks:
- 164
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 44
- Referring IPs:
- 12
- Authority Domain Score:
- 23
Backlinks by country
- Country
- Domains
- Singapore 34
- United States 6
- France 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .in
- 32
- .com
- 5
- .net
- 3
- .edu
- 0
- .gov
- 0
Which sites are competitors to eigsica.ma?
Websites similar to eigsica.ma are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 426 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with eigsica.ma in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 458
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- eigsica.ma
- Rank:
(Rank based on keywords, cost and organic traffic) - 25,162,590
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 11
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $1 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $28.8 and annual gross revenue of approximately $350.4. Based on these figures, the site's net worth is estimated at around $860.8.How much would eigsica.ma make?
- Daily Revenue:
- $0.96
- Monthly Revenue:
- $28.80
- Yearly Revenue:
- $350.40
Daily earning by country
- CountryPageviewsEarning
- United States 18$0.09
- Senegal 19$0.04
- Morocco 25$0.02
- Mexico 17$0.00
- Turkey 20$0.00
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.02
- Monthly Revenue Loss:
- $0.53
- Yearly Revenue Loss:
- $6.40
- Daily Pageviews Blocked:
- 7
- Monthly Pageviews Blocked:
- 213
- Yearly Pageviews Blocked:
- 2,595
Daily revenue loss by country
- CountryBlockedLost Money
- United States 3$0.02
- Senegal 0$0.00
- Mexico 2$0.00
- Morocco 1$0.00
- Turkey 1$0.00
How much is eigsica.ma worth?
- Website Value:
- $860.8
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- eigsica.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- eigsica.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- eigsica.ma
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is eigsica.ma hosted? ▼
Eigsica.ma may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 95.142.172.156
- ASN:
- AS203476
- ISP:
- GANDI SAS
- Server Location:
France, FR
Other sites hosted on 95.142.172.156
How fast does eigsica.ma load? ▼
The average loading time of eigsica.ma is 1102 ms.- Average Load Time:
- 1102 ms
Does eigsica.ma use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on eigsica.ma are reduced by 81%.
eigsica.ma use gzip compression.
Original size: 89.83 KB
Compressed size: 16.31 KB
File reduced by: 73.52 KB (81%)
Compressed size: 16.31 KB
File reduced by: 73.52 KB (81%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. eigsica.ma supports HTTPS. eigsica.ma supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.eigsica.ma
Organization:
Location:
Issuer: R3
Valid from: Sep 20 19:13:40 2023 GMT
Valid until: Dec 19 19:13:39 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R3
Valid from: Sep 20 19:13:40 2023 GMT
Valid until: Dec 19 19:13:39 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R3
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: ISRG Root X1
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. eigsica.ma does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Date: Thu, 12 Oct 2023 11:22:03 GMT
Server: Apache
Location: https://www.eigsica.ma/
Content-Length: 1
Content-Type: text/html; charset=UTF-8
HTTP/1.1 200 OK
Date: Thu, 12 Oct 2023 11:22:03 GMT
Server: Apache
Set-Cookie: utm_source=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; Max-Age=0; path=/; domain=.eigsica.ma
Set-Cookie: utm_medium=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; Max-Age=0; path=/; domain=.eigsica.ma
Set-Cookie: utm_term=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; Max-Age=0; path=/; domain=.eigsica.ma
Set-Cookie: utm_content=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; Max-Age=0; path=/; domain=.eigsica.ma
Set-Cookie: utm_campaign=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; Max-Age=0; path=/; domain=.eigsica.ma
Set-Cookie: gclid=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; Max-Age=0; path=/; domain=.eigsica.ma
Set-Cookie: handl_original_ref=https%3A%2F%2Fhypestat.com; expires=Sat, 11-Nov-2023 11:22:03 GMT; Max-Age=2592000; path=/; domain=.eigsica.ma
Set-Cookie: handl_landing_page=https%3A%2F%2Fwww.eigsica.ma%2F; expires=Sat, 11-Nov-2023 11:22:03 GMT; Max-Age=2592000; path=/; domain=.eigsica.ma
Set-Cookie: handl_ip=108.178.0.234; expires=Sat, 11-Nov-2023 11:22:03 GMT; Max-Age=2592000; path=/; domain=.eigsica.ma
Set-Cookie: handl_ref=https%3A%2F%2Fhypestat.com; expires=Sat, 11-Nov-2023 11:22:03 GMT; Max-Age=2592000; path=/; domain=.eigsica.ma
Set-Cookie: handl_url=https%3A%2F%2Fwww.eigsica.ma%2F; expires=Sat, 11-Nov-2023 11:22:03 GMT; Max-Age=2592000; path=/; domain=.eigsica.ma
Set-Cookie: email=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; Max-Age=0; path=/; domain=.eigsica.ma
Set-Cookie: username=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; Max-Age=0; path=/; domain=.eigsica.ma
Link: <https://www.eigsica.ma/wp-json/>; rel="https://api.w.org/"
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 16700
Content-Type: text/html; charset=UTF-8
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
TXT | 3600 | ||
TXT | 3600 | ||
TXT | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
SOA | 3600 | ||
Mname | ns1.eigsica.ma | ||
Rname | named.eigsica.ma | ||
Serial Number | 2023091401 | ||
Refresh | 10800 | ||
Retry | 3600 | ||
Expire | 604800 | ||
Minimum TTL | 3600 | ||
A | 95.142.172.156 | 3514 | |
NS | 3600 | ||
NS | 3600 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on July 26, 2006 and will expire on July 25, 2024 if not renewed. This website is now assigned through the registrar MAROC HOST DATA CENTER. The WHOIS data for this website's domain was last updated on June 15, 2023.- Domain Created:
- 2006-07-26
- Domain Expires:
- 2024-07-25
- Domain Updated:
- 2023-06-15
- Domain Age:
- 18 years 4 months 16 days
- Domain Registrar:
- MAROC HOST DATA CENTER
- Domain Owner:
- EIGSI
- WhoIs:
Domain Name: eigsica.ma Updated Date: 2023-06-15T09:34:30.011Z Creation Date: 2006-07-26T00:00:00.000Z Registry Expiry Date: 2024-07-25T23:00:00.000Z Sponsoring Registrar: MAROC HOST DATA CENTER Domain Status: ok Registrant Name: EIGSI Admin Name: Chebli Reda Admin Phone: +212.537643604 Admin Phone Ext: Admin Email: Tech Name: Nerrand Olivier Tech Phone: +212.537643604 Tech Phone Ext: Tech Email: Name Server: ns1.eigsica.ma Name Server: ns2.eigsica.ma >>> Last update of WHOIS database: 2023-10-12T11:23:22.478Z