Jereussirai.com
Etude et résumés des œuvres, leçons, exercices et examens!
Domain Summary
What is the traffic rank for Jereussirai.com?
• Jereussirai.com ranks #6,753,277 globally on HypeStat.
What percent of global Internet users visit Jereussirai.com?
• 2.2E-6% of global Internet users visit Jereussirai.com
How many people visit Jereussirai.com each day?
• Jereussirai.com receives approximately 110 visitors and 111 page impressions per day.
Which countries does Jereussirai.com receive most of its visitors from?
• Jereussirai.com is mostly visited by people located in Morocco,Mexico,Portugal.
How much Jereussirai.com can earn?
• Jereussirai.com should earn about $0.09/day from advertising revenue.
What is Jereussirai.com estimated value?
• Estimated value of Jereussirai.com is $80.57.
What IP addresses does Jereussirai.com resolve to?
• Jereussirai.com resolves to the IP addresses 2606:4700:3036::ac43:c46f, 104.21.44.63.
jereussirai.com Profile

Title:Etude et résumés des œuvres, leçons, exercices et examens!
Description:Site pour candidats à l'examen régional de la 1ère année bac, présentant des études des œuvres, des leçons de langue, des exercices et des examens régionaux
Tags:
Category:Science and Education / Education
What technologies does jereussirai.com use?
These are the technologies used at jereussirai.com. jereussirai.com has a total of 5 technologies installed in 3 different categories.jereussirai.com Traffic Analysis
Jereussirai.com is ranked #6,753,277 in the world. This website is viewed by an estimated 110 visitors daily, generating a total of 111 pageviews. This equates to about 3.3K monthly visitors.Daily Visitors110
Monthly Visits3.3K
Pages per Visit1.01
Visit duration01:55
Bounce Rate56.14%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 110
- Monthly Visits:
- 3,333
- Pages per Visit:
- 1.01
- Daily Pageviews:
- 111
- Avg. visit duration:
- 01:55
- Bounce rate:
- 56.14%
- Global Reach:
- 2.2E-6%
- Monthly Visits (SimilarWeb):
- 3,226
- HypeRank:
- 6,753,277
- SEMrush Rank:
- 41,307,828
- SimilarWeb Rank:
- 5,850,572
Total Visits Last 3 Months
5.4K
JUL
3.3K
AUG
3.3K
SEP
Visitors by country
- Country
- Users%
- Morocco 28.06%
- Mexico 25.32%
- Portugal 18.25%
- United Kingdom 16.07%
- France 12.30%
Backlinks Report ▼
Jereussirai.com has a total of 58 backlinks from 44 referring domains and most of them comes from Singapore.- Total Backlinks:
- 58
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 44
- Referring IPs:
- 21
- Authority Domain Score:
- 11
Backlinks by country
- Country
- Domains
- Singapore 29
- United States 11
- Germany 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 14
- .pw
- 13
- .in
- 7
- .edu
- 0
- .gov
- 0
Which sites are competitors to jereussirai.com?
Websites similar to jereussirai.com are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 526 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with jereussirai.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 186
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- jereussirai.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 41,307,828
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 1
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $0.1 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $2.7 and annual gross revenue of approximately $32.9. Based on these figures, the site's net worth is estimated at around $80.6.How much would jereussirai.com make?
- Daily Revenue:
- $0.09
- Monthly Revenue:
- $2.70
- Yearly Revenue:
- $32.85
Daily earning by country
- CountryPageviewsEarning
- United Kingdom 18$0.05
- Morocco 31$0.02
- France 14$0.01
- Mexico 28$0.01
- Portugal 20$0.00
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.01
- Monthly Revenue Loss:
- $0.32
- Yearly Revenue Loss:
- $3.85
- Daily Pageviews Blocked:
- 12
- Monthly Pageviews Blocked:
- 353
- Yearly Pageviews Blocked:
- 4,293
Daily revenue loss by country
- CountryBlockedLost Money
- United Kingdom 3$0.01
- Portugal 4$0.00
- France 2$0.00
- Mexico 3$0.00
- Morocco 1$0.00
How much is jereussirai.com worth?
- Website Value:
- $80.6
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- jereussirai.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- jereussirai.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- jereussirai.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is jereussirai.com hosted? ▼
Jereussirai.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 2606:4700:3036::ac43:c46f, 104.21.44.63
- ASN:
- AS13335
- ISP:
- Cloudflare Inc
- Server Location:
Other sites hosted on 104.21.44.63
How fast does jereussirai.com load? ▼
The average loading time of jereussirai.com is 504 ms. The Desktop speed index is 85 and mobile speed index is 84.- Average Load Time:
- 504 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Largest Contentful Paint image was not lazily loaded
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Speed Index 1.9 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
Time to Interactive 1.5 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Max Potential First Input Delay 30 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
First Contentful Paint 1.5 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
First Meaningful Paint 1.5 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Largest Contentful Paint 1.8 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Total Blocking Time 0 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Speed Index 4.3 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
First Meaningful Paint 3.1 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Preload Largest Contentful Paint image
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
Largest Contentful Paint image was not lazily loaded
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
First Contentful Paint 3.1 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Time to Interactive 4.8 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Max Potential First Input Delay 110 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Total Blocking Time 40 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Largest Contentful Paint 3.4 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Does jereussirai.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on jereussirai.com are reduced by 73%.
jereussirai.com use br compression.
Original size: 22.58 KB
Compressed size: 6.09 KB
File reduced by: 16.48 KB (73%)
Compressed size: 6.09 KB
File reduced by: 16.48 KB (73%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. jereussirai.com supports HTTPS. jereussirai.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: jereussirai.com
Organization:
Location:
Issuer: E1
Valid from: Sep 13 07:13:56 2023 GMT
Valid until: Dec 12 07:13:55 2023 GMT
Authority: CA:FALSE
Keysize:
Organization:
Location:
Issuer: E1
Valid from: Sep 13 07:13:56 2023 GMT
Valid until: Dec 12 07:13:55 2023 GMT
Authority: CA:FALSE
Keysize:
Common Name: E1
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X2
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize:
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X2
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize:
Common Name: ISRG Root X2
Organization: Internet Security Research Group
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize:
Organization: Internet Security Research Group
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize:
Common Name: ISRG Root X1
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. jereussirai.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.date: Thu, 12 Oct 2023 12:36:02 GMT
content-type: text/html
last-modified: Tue, 28 Feb 2023 21:55:13 GMT
vary: Accept-Encoding
cf-cache-status: DYNAMIC
report-to: {"endpoints":[{"url":"https://a.nel.cloudflare.com/report/v3?s=g5FfZ9tK8KPq%2BQ90xvw7%2BEIMLbi8PrKaoBLY%2B7SxsMKplpRBgA%2BKiM5yT1oUO9PUj%2FoPnTgIZciFvQ%2BkLODgaWF2qvFeO%2FkoEPHJDHVGNykyzroQQbIxcYMXKwP5WZAcCvM%3D"}],"group":"cf-nel","max_age":604800}
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
cf-ray: 814f62dacad6118b-ORD
content-encoding: br
alt-svc: h3=":443"; ma=86400
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
HINFO | 3600 | ||
AAAA | 2606:4700:3030::6815:2c3f | 251 | |
AAAA | 2606:4700:3036::ac43:c46f | 251 | |
A | 172.67.196.111 | 251 | |
A | 104.21.44.63 | 251 | |
NS | 172751 | ||
NS | 172751 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on January 3, 2020 and will expire on January 3, 2024 if not renewed. This website is now assigned through the registrar GoDaddy.com, LLC. The WHOIS data for this website's domain was last updated on January 4, 2023.- Domain Created:
- 2020-01-03
- Domain Expires:
- 2024-01-03
- Domain Updated:
- 2023-01-04
- Domain Age:
- 5 years 2 months 19 days
- Domain Registrar:
- GoDaddy.com, LLC
- Domain Owner:
- Domains By Proxy, LLC
- WhoIs:
Domain Name: jereussirai.com Registry Domain ID: 2475402764_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: https://www.godaddy.com Updated Date: 2023-01-04T08:26:40Z Creation Date: 2020-01-03T11:48:44Z Registrar Registration Expiration Date: 2024-01-03T11:48:44Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Registrant Street: DomainsByProxy.com Registrant Street: 2155 E Warner Rd Registrant City: Tempe Registrant State/Province: Arizona Registrant Postal Code: 85284 Registrant Country: US Registrant Phone: +1.4806242599 Registrant Phone Ext: Registrant Fax: +1.4806242598 Registrant Fax Ext: Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=jereussirai.com Registry Admin ID: Not Available From Registry Admin Name: Registration Private Admin Organization: Domains By Proxy, LLC Admin Street: DomainsByProxy.com Admin Street: 2155 E Warner Rd Admin City: Tempe Admin State/Province: Arizona Admin Postal Code: 85284 Admin Country: US Admin Phone: +1.4806242599 Admin Phone Ext: Admin Fax: +1.4806242598 Admin Fax Ext: Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=jereussirai.com Registry Tech ID: Not Available From Registry Tech Name: Registration Private Tech Organization: Domains By Proxy, LLC Tech Street: DomainsByProxy.com Tech Street: 2155 E Warner Rd Tech City: Tempe Tech State/Province: Arizona Tech Postal Code: 85284 Tech Country: US Tech Phone: +1.4806242599 Tech Phone Ext: Tech Fax: +1.4806242598 Tech Fax Ext: Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=jereussirai.com Name Server: NITIN.NS.CLOUDFLARE.COM Name Server: TEGAN.NS.CLOUDFLARE.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-10-12T12:36:50Z