Osd.ma
Site Officiel Centre ÖSD MAROKKO
Domain Summary
What is the traffic rank for Osd.ma?
• Osd.ma ranks #4,367,371 globally on HypeStat.
How many people visit Osd.ma each day?
• Osd.ma receives approximately 829 visitors and 2,930 page impressions per day.
Which countries does Osd.ma receive most of its visitors from?
• Osd.ma is mostly visited by people located in Morocco.
How much Osd.ma can earn?
• Osd.ma should earn about $1.76/day from advertising revenue.
What is Osd.ma estimated value?
• Estimated value of Osd.ma is $1,509.26.
What IP addresses does Osd.ma resolve to?
• Osd.ma resolves to the IP addresses 2a07:7800::142, 185.151.30.142.
Where are Osd.ma servers located in?
• Osd.ma has servers located in United Kingdom.
osd.ma Profile
![osd.ma osd.ma](https://hypestat.b-cdn.net/screenshot/o/s/d/m/osd.ma.webp)
Title:Site Officiel Centre ÖSD MAROKKO
Description:Centre ÖSD MAROC FES
Tags:
Category:Science and Education / Education
What technologies does osd.ma use?
These are the technologies used at osd.ma. osd.ma has a total of 10 technologies installed in 7 different categories.osd.ma Traffic Analysis
Osd.ma is ranked #4,367,371 in the world. This website is viewed by an estimated 829 visitors daily, generating a total of 2.9K pageviews. This equates to about 25.1K monthly visitors. Osd.ma traffic has decreased by 4.81% compared to last month.Daily Visitors829
129.39%
Monthly Visits25.1K
4.81%
Pages per Visit3.54
13.73%
Visit duration02:38
37.19%
Bounce Rate47.92%
32.61%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 829
- Monthly Visits:
- 25,119
- Pages per Visit:
- 3.54
- Daily Pageviews:
- 2,930
- Avg. visit duration:
- 02:38
- Bounce rate:
- 47.92%
- Global Reach:
- n/a
- Monthly Visits (SEMrush):
- 83,859
- Monthly Unique Visitors (SEMrush):
- 19,303
- Monthly Visits (SimilarWeb):
- 24,614
- HypeRank:
- 4,367,371
- SEMrush Rank:
- 14,170,793
- SimilarWeb Rank:
- 1,315,774
Traffic sources
- Direct:
- 71.05%
- Referral:
- 0%
- Search:
- 28.95%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 0.35%
- Mobile:
- 99.65%
Total Visits Last 3 Months
28.5K
SEP
26.4K
OCT
25.1K
NOV
Visitors by country
- Country
- Users%
- Morocco 100.00%
Backlinks Report ▼
Osd.ma has a total of 689 backlinks from 134 referring domains and most of them comes from Singapore.- Total Backlinks:
- 689
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 134
- Referring IPs:
- 35
- Authority Domain Score:
- 38
Backlinks by country
- Country
- Domains
- Singapore 110
- United States 18
- Morocco 1
- Germany 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .pw
- 63
- .in
- 27
- .com
- 17
- .edu
- 0
- .gov
- 0
Which sites are competitors to osd.ma?
Websites similar to osd.ma are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 538 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with osd.ma in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- osd.ma
- Rank:
(Rank based on keywords, cost and organic traffic) - 14,170,793
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 3
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $1.8 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $52.8 and annual gross revenue of approximately $642.4. Based on these figures, the site's net worth is estimated at around $1.5K.How much would osd.ma make?
- Daily Revenue:
- $1.76
- Monthly Revenue:
- $52.80
- Yearly Revenue:
- $642.40
Daily earning by country
- CountryPageviewsEarning
- Morocco 2,930$1.76
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.04
- Monthly Revenue Loss:
- $1.05
- Yearly Revenue Loss:
- $12.83
- Daily Pageviews Blocked:
- 59
- Monthly Pageviews Blocked:
- 1,758
- Yearly Pageviews Blocked:
- 21,389
Daily revenue loss by country
- CountryBlockedLost Money
- Morocco 59$0.04
How much is osd.ma worth?
- Website Value:
- $1.5K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- osd.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- osd.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- osd.ma
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is osd.ma hosted? ▼
Osd.ma may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 2a07:7800::142, 185.151.30.142
- ASN:
- AS48254
- ISP:
- OSS Ural Ltd.
- Server Location:
United Kingdom, GB
Other sites hosted on 185.151.30.142
Does osd.ma use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on osd.ma are reduced by 74%.
osd.ma use gzip compression.
Original size: 18.66 KB
Compressed size: 4.78 KB
File reduced by: 13.88 KB (74%)
Compressed size: 4.78 KB
File reduced by: 13.88 KB (74%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. osd.ma supports HTTPS. osd.ma supports HTTPS
Verifying SSL Support. Please wait...
Common Name: *.osd.ma
Organization:
Location:
Issuer: R3
Valid from: Dec 15 23:50:48 2022 GMT
Valid until: Mar 15 23:50:47 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R3
Valid from: Dec 15 23:50:48 2022 GMT
Valid until: Mar 15 23:50:47 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R3
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: ISRG Root X1
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. osd.ma supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.date: Mon, 26 Dec 2022 21:27:58 GMT
content-type: text/html; charset=UTF-8
vary: Accept-Encoding
server: Apache
x-powered-by: PHP/7.0.33
x-provided-by: StackCDN
x-provided-by: StackCDN
vary: Accept-Encoding
x-origin-cache-status: MISS
content-encoding: gzip
x-cdn-cache-status: MISS
x-via: ORD1
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 3600 | ||
Mname | ns1.stackdns.com | ||
Rname | hostmaster.stackdns.com | ||
Serial Number | 1637398473 | ||
Refresh | 1800 | ||
Retry | 900 | ||
Expire | 1209600 | ||
Minimum TTL | 300 | ||
TXT | 3600 | ||
MX | 3600 | ||
AAAA | 2a07:7800::142 | 3600 | |
A | 185.151.30.142 | 3542 | |
NS | 3541 | ||
NS | 3541 | ||
NS | 3541 | ||
NS | 3541 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 17, 2019 and will expire on June 17, 2023 if not renewed. This website is now assigned through the registrar CREATIVE INTERNET SOLUTIONS. The WHOIS data for this website's domain was last updated on February 11, 2022.- Domain Created:
- 2019-06-17
- Domain Expires:
- 2023-06-17
- Domain Updated:
- 2022-02-11
- Domain Age:
- 4 years 29 days
- Domain Registrar:
- CREATIVE INTERNET SOLUTIONS
- Domain Owner:
- RACHID JAI MANSOURI
- WhoIs:
Domain Name: osd.ma Updated Date: 2022-02-11T13:40:22.607Z Creation Date: 2019-06-17T19:05:25.096Z Registry Expiry Date: 2023-06-17T19:05:28.488Z Sponsoring Registrar: CREATIVE INTERNET SOLUTIONS Domain Status: ok Registrant Name: RACHID JAI MANSOURI Admin Name: RACHID JAI MANSOURI Admin Phone: +212.535604454 Admin Phone Ext: Admin Email:Tech Name: RACHID JAI MANSOURI Tech Phone: +212.535604454 Tech Phone Ext: Tech Email:
Name Server: ns1.stackdns.com Name Server: ns2.stackdns.com Name Server: ns3.stackdns.com Name Server: ns4.stackdns.com Name Server: ns10.vala-bleu.ma >>> Last update of WHOIS database: 2022-12-26T21:28:03.272Z