9rytna.info
9rytnaDomain Summary
What is the traffic rank for 9rytna.info?
• 9rytna.info ranks #3,853,586 globally on HypeStat.
What percent of global Internet users visit 9rytna.info?
• 7.4E-6% of global Internet users visit 9rytna.info
How many people visit 9rytna.info each day?
• 9rytna.info receives approximately 363 visitors and 710 page impressions per day.
How much 9rytna.info can earn?
• 9rytna.info should earn about $2.90/day from advertising revenue.
What is 9rytna.info estimated value?
• Estimated value of 9rytna.info is $2,533.03.
What IP addresses does 9rytna.info resolve to?
• 9rytna.info resolves to the IP addresses 216.239.34.21.
Where are 9rytna.info servers located in?
• 9rytna.info has servers located in California, United States.
9rytna.info Profile
Title:9rytna
Description:9rytna est une plateforme éducatif pour les étudiants de licence sciences économiques et gestion, licence droit et science politique, Master sciences économiques et gestion, Master droit et science politique.
Category:Science and Education / Education
What technologies does 9rytna.info use?
These are the technologies used at 9rytna.info. 9rytna.info has a total of 11 technologies installed in 8 different categories.9rytna.info Traffic Analysis
9rytna.info is ranked #3,853,586 in the world. This website is viewed by an estimated 363 visitors daily, generating a total of 710 pageviews. This equates to about 11K monthly visitors. 9rytna.info traffic has increased by 3321.82% compared to last month.Daily Visitors363
3321.82%
Monthly Visits11K
3321.82%
Pages per Visit1.95
2%
Visit duration02:41
Bounce Rate59.79%
2.14%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 363
- Monthly Visits:
- 10,999
- Pages per Visit:
- 1.95
- Daily Pageviews:
- 710
- Avg. visit duration:
- 02:41
- Bounce rate:
- 59.79%
- Global Reach:
- 7.4E-6%
- Monthly Visits (SEMrush):
- 3,764
- Monthly Unique Visitors (SEMrush):
- 3,764
- Monthly Visits (SimilarWeb):
- 10,787
- HypeRank:
- 3,853,586
- SimilarWeb Rank:
- 3,195,253
Traffic sources
- Direct:
- 47.86%
- Referral:
- 0%
- Search:
- 52.14%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 4.28%
- Mobile:
- 95.72%
Total Visits Last 3 Months
5.3K
MAR
321.4
APR
11K
MAY
Backlinks Report ▼
9rytna.info has a total of 110 backlinks from 68 referring domains and most of them comes from United States.- Total Backlinks:
- 110
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 68
- Referring IPs:
- 19
- Authority Domain Score:
- 19
Backlinks by country
- Country
- Domains
- United States 43
- Singapore 24
- Germany 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .pw
- 29
- .in
- 19
- .com
- 16
- .edu
- 0
- .gov
- 0
Which sites are competitors to 9rytna.info?
Websites similar to 9rytna.info are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 375 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with 9rytna.info in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 361
- Bing Index:
- 358
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- 9rytna.info
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $2.9 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $87 and annual gross revenue of approximately $1.1K. Based on these figures, the site's net worth is estimated at around $2.5K.How much would 9rytna.info make?
- Daily Revenue:
- $2.90
- Monthly Revenue:
- $87.00
- Yearly Revenue:
- $1,058.50
How much is 9rytna.info worth?
- Website Value:
- $2.5K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- 9rytna.info
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- 9rytna.info
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- 9rytna.info
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is 9rytna.info hosted? ▼
9rytna.info may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 216.239.34.21
- ASN:
- AS15169
- ISP:
- Google LLC
- Server Location:
- California, CA
United States, US
Other sites hosted on 216.239.34.21
How fast does 9rytna.info load? ▼
The average loading time of 9rytna.info is 237 ms. The Desktop speed index is 75 and mobile speed index is 7.- Average Load Time:
- 237 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a AVERAGE speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)2.2s
First Input Delay (FID)4ms
Origin Data
All pages served from this origin have an AVERAGE speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)2.2s
First Input Delay (FID)4ms
Lab Data
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Preload Largest Contentful Paint image
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
Speed Index 1.2 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
First Meaningful Paint 1.0 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Largest Contentful Paint image was not lazily loaded
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Max Potential First Input Delay 80 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
Total Blocking Time 10 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
First Contentful Paint 1.0 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Time to Interactive 1.5 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Largest Contentful Paint 1.4 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a SLOW speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)2.4s
First Input Delay (FID)29ms
Origin Data
All pages served from this origin have an SLOW speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)2.4s
First Input Delay (FID)29ms
Lab Data
Largest Contentful Paint 7.8 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Preload Largest Contentful Paint image
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
Total Blocking Time 2,730 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
First Meaningful Paint 3.6 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Time to Interactive 17.5 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Largest Contentful Paint image was not lazily loaded
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
First Contentful Paint 3.6 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Max Potential First Input Delay 580 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Speed Index 9.1 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Does 9rytna.info use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on 9rytna.info are reduced by 80%.
9rytna.info use gzip compression.
Original size: 170.03 KB
Compressed size: 33.9 KB
File reduced by: 136.12 KB (80%)
Compressed size: 33.9 KB
File reduced by: 136.12 KB (80%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. 9rytna.info supports HTTPS. 9rytna.info supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.9rytna.info
Organization:
Location:
Issuer: GTS CA 1D4
Valid from: Jun 1 01:26:33 2023 GMT
Valid until: Aug 30 02:07:19 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: GTS CA 1D4
Valid from: Jun 1 01:26:33 2023 GMT
Valid until: Aug 30 02:07:19 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: GTS CA 1D4
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: GTS Root R1
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. 9rytna.info supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.location: https://www.9rytna.info/
date: Mon, 12 Jun 2023 04:37:03 GMT
content-type: text/html; charset=UTF-8
server: ghs
content-length: 221
x-xss-protection: 0
x-frame-options: SAMEORIGIN
HTTP/2 200
x-robots-tag: all,noodp
content-type: text/html; charset=UTF-8
expires: Mon, 12 Jun 2023 04:37:03 GMT
date: Mon, 12 Jun 2023 04:37:03 GMT
cache-control: private, max-age=0
last-modified: Sun, 11 Jun 2023 14:24:09 GMT
etag: W/"5ad2602ecd2d7bbf52277119993eb1b046720a90ae3884249f3a940b432e794d"
content-encoding: gzip
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
content-length: 34717
server: GSE
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
HINFO | 3600 | ||
NS | 3600 | ||
NS | 3600 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on March 13, 2021 and will expire on March 13, 2024 if not renewed. This website is now assigned through the registrar NAMECHEAP INC. The WHOIS data for this website's domain was last updated on February 11, 2023.- Domain Created:
- 2021-03-13
- Domain Expires:
- 2024-03-13
- Domain Updated:
- 2023-02-11
- Domain Age:
- 3 years 3 months 8 days
- Domain Registrar:
- NAMECHEAP INC
- Domain Owner:
- Privacy service provided by Withheld for Privacy e
- WhoIs:
Domain name: 9rytna.info Registry Domain ID: 252d151f162c4e1da55590767fe16ba0-DONUTS Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 2023-02-11T10:23:08.44Z Creation Date: 2021-03-13T14:57:58.52Z Registrar Registration Expiration Date: 2024-03-13T14:57:58.52Z Registrar: NAMECHEAP INC Registrar IANA ID: 1068 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.9854014545 Reseller: NAMECHEAP INC Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: Redacted for Privacy Registrant Organization: Privacy service provided by Withheld for Privacy ehf Registrant Street: Kalkofnsvegur 2 Registrant City: Reykjavik Registrant State/Province: Capital Region Registrant Postal Code: 101 Registrant Country: IS Registrant Phone: +354.4212434 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Registry Admin ID: Admin Name: Redacted for Privacy Admin Organization: Privacy service provided by Withheld for Privacy ehf Admin Street: Kalkofnsvegur 2 Admin City: Reykjavik Admin State/Province: Capital Region Admin Postal Code: 101 Admin Country: IS Admin Phone: +354.4212434 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Registry Tech ID: Tech Name: Redacted for Privacy Tech Organization: Privacy service provided by Withheld for Privacy ehf Tech Street: Kalkofnsvegur 2 Tech City: Reykjavik Tech State/Province: Capital Region Tech Postal Code: 101 Tech Country: IS Tech Phone: +354.4212434 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Name Server: dns1.registrar-servers.com Name Server: dns2.registrar-servers.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-06-11T13:38:14.26Z