Taalime24.com
Ù ÙÙع تعÙÙÙ 24Domain Summary
What is the traffic rank for Taalime24.com?
• Taalime24.com ranks #3,517,387 globally on HypeStat.
What percent of global Internet users visit Taalime24.com?
• 1.04E-5% of global Internet users visit Taalime24.com
How many people visit Taalime24.com each day?
• Taalime24.com receives approximately 513 visitors and 973 page impressions per day.
How much Taalime24.com can earn?
• Taalime24.com should earn about $3.97/day from advertising revenue.
What is Taalime24.com estimated value?
• Estimated value of Taalime24.com is $3,464.00.
What IP addresses does Taalime24.com resolve to?
• Taalime24.com resolves to the IP addresses 216.239.34.21.
Where are Taalime24.com servers located in?
• Taalime24.com has servers located in California, United States.
taalime24.com Profile
Title:
Ù
ÙÙع تعÙÙÙ
24
Description:Ù
دÙÙØ© اÙتعÙÙÙ
Ù
Ù Ù
ستجدات درÙس ÙÙ
اذج ÙرÙض اÙ
تØاÙات Ù
ÙØدة Ù
ØÙÙØ© جÙÙÙØ© ÙØ·ÙÙØ©
Category:Science and Education / Education
What technologies does taalime24.com use?
These are the technologies used at taalime24.com. taalime24.com has a total of 13 technologies installed in 9 different categories.taalime24.com Traffic Analysis
Taalime24.com is ranked #3,517,387 in the world. This website is viewed by an estimated 513 visitors daily, generating a total of 1K pageviews. This equates to about 15.5K monthly visitors. Taalime24.com traffic has increased by 112.53% compared to last month.Daily Visitors513
146.8%
Monthly Visits15.5K
112.53%
Pages per Visit1.90
95.44%
Visit duration02:12
22.46%
Bounce Rate50.44%
31.16%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 513
- Monthly Visits:
- 15,544
- Pages per Visit:
- 1.90
- Daily Pageviews:
- 973
- Avg. visit duration:
- 02:12
- Bounce rate:
- 50.44%
- Global Reach:
- 1.04E-5%
- Monthly Visits (SEMrush):
- 5,192
- Monthly Unique Visitors (SEMrush):
- 5,168
- Monthly Visits (SimilarWeb):
- 15,076
- HypeRank:
- 3,517,387
- SimilarWeb Rank:
- 2,390,426
Traffic sources
- Direct:
- 48.37%
- Referral:
- 0.65%
- Search:
- 50.97%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 3.26%
- Mobile:
- 96.74%
Total Visits Last 3 Months
10.3K
FEB
7.3K
MAR
15.5K
APR
Backlinks Report ▼
Taalime24.com has a total of 479 backlinks from 100 referring domains and most of them comes from United States.- Total Backlinks:
- 479
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 100
- Referring IPs:
- 46
- Authority Domain Score:
- 10
Backlinks by country
- Country
- Domains
- United States 54
- Singapore 33
- Russian Federation 1
- Germany 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .pw
- 43
- .com
- 31
- .in
- 10
- .edu
- 0
- .gov
- 0
Which sites are competitors to taalime24.com?
Websites similar to taalime24.com are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 387 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with taalime24.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 3,270
- Bing Index:
- 5,090
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- taalime24.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $4 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $119.1 and annual gross revenue of approximately $1.4K. Based on these figures, the site's net worth is estimated at around $3.5K.How much would taalime24.com make?
- Daily Revenue:
- $3.97
- Monthly Revenue:
- $119.10
- Yearly Revenue:
- $1,449.05
How much is taalime24.com worth?
- Website Value:
- $3.5K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- taalime24.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- taalime24.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- taalime24.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is taalime24.com hosted? ▼
Taalime24.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 216.239.34.21
- ASN:
- AS15169
- ISP:
- Google LLC
- Server Location:
- California, CA
United States, US
Other sites hosted on 216.239.34.21
How fast does taalime24.com load? ▼
The average loading time of taalime24.com is 527 ms. The Desktop speed index is 0 and mobile speed index is 31.- Average Load Time:
- 527 ms
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a SLOW speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)1.8s
First Input Delay (FID)0
Origin Data
All pages served from this origin have an AVERAGE speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)2.1s
First Input Delay (FID)18ms
Lab Data
Max Potential First Input Delay 350 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
First Meaningful Paint 4.5 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Total Blocking Time 1,140 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Time to Interactive 16.1 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
First Contentful Paint 2.8 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Largest Contentful Paint image was not lazily loaded
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Speed Index 8.7 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Largest Contentful Paint 4.6 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Does taalime24.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on taalime24.com are reduced by 85%.
taalime24.com use gzip compression.
Original size: 362.91 KB
Compressed size: 53.76 KB
File reduced by: 309.15 KB (85%)
Compressed size: 53.76 KB
File reduced by: 309.15 KB (85%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. taalime24.com supports HTTPS. taalime24.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.taalime24.com
Organization:
Location:
Issuer: GTS CA 1D4
Valid from: May 4 22:50:07 2023 GMT
Valid until: Aug 2 23:39:59 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: GTS CA 1D4
Valid from: May 4 22:50:07 2023 GMT
Valid until: Aug 2 23:39:59 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: GTS CA 1D4
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: GTS Root R1
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. taalime24.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.location: https://www.taalime24.com/
date: Wed, 31 May 2023 07:29:09 GMT
content-type: text/html; charset=UTF-8
server: ghs
content-length: 223
x-xss-protection: 0
x-frame-options: SAMEORIGIN
HTTP/2 200
content-type: text/html; charset=UTF-8
expires: Wed, 31 May 2023 07:29:09 GMT
date: Wed, 31 May 2023 07:29:09 GMT
cache-control: private, max-age=0
last-modified: Tue, 30 May 2023 17:22:25 GMT
etag: W/"f6b2eedcd10d701084f0a6c869552c1f322dca120b516c442886876ebdc0cda7"
x-robots-tag: all
content-encoding: gzip
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
content-length: 55047
server: GSE
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 3494 | ||
Mname | mercury.wassla.net | ||
Rname | prof.geograph2003.gmail.com | ||
Serial Number | 2016021209 | ||
Refresh | 7200 | ||
Retry | 7200 | ||
Expire | 172800 | ||
Minimum TTL | 7200 | ||
MX | 3494 | ||
MX | 3494 | ||
MX | 3494 | ||
TXT | 3494 | ||
A | 216.239.32.21 | 3484 | |
A | 216.239.36.21 | 3484 | |
A | 162.215.226.6 | 3484 | |
A | 216.239.34.21 | 3484 | |
A | 216.239.38.21 | 3484 | |
NS | 3484 | ||
NS | 3484 | ||
NS | 3484 | ||
NS | 3484 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on February 12, 2016 and will expire on February 12, 2025 if not renewed. This website is now assigned through the registrar PDR Ltd. d/b/a PublicDomainRegistry.com. The WHOIS data for this website's domain was last updated on January 21, 2021.- Domain Created:
- 2016-02-12
- Domain Expires:
- 2025-02-12
- Domain Updated:
- 2021-01-21
- Domain Age:
- 8 years 4 months 9 days
- Domain Registrar:
- PDR Ltd. d/b/a PublicDomainRegistry.com
- Domain Owner:
- Oumsahel Ibrahim
- WhoIs:
Domain Name: TAALIME24.COM Registry Domain ID: 2002186147_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.publicdomainregistry.com Registrar URL: www.publicdomainregistry.com Updated Date: 2021-01-21T09:09:21Z Creation Date: 2016-02-12T16:07:03Z Registrar Registration Expiration Date: 2025-02-12T16:07:03Z Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Oumsahel Ibrahim Registrant Organization: Registrant Street: 125 rue alaouin Registrant City: Rabat Registrant State/Province: Rabat Registrant Postal Code: 10000 Registrant Country: MA Registrant Phone: +212.0672771029 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Registry Admin ID: Not Available From Registry Admin Name: Oumsahel Ibrahim Admin Organization: Admin Street: 125 rue alaouin Admin City: Rabat Admin State/Province: Rabat Admin Postal Code: 10000 Admin Country: MA Admin Phone: +212.0672771029 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Registry Tech ID: Not Available From Registry Tech Name: Oumsahel Ibrahim Tech Organization: Tech Street: 125 rue alaouin Tech City: Rabat Tech State/Province: Rabat Tech Postal Code: 10000 Tech Country: MA Tech Phone: +212.0672771029 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Name Server: sale460244.earth.orderbox-dns.com Name Server: sale460244.mars.orderbox-dns.com Name Server: sale460244.mercury.orderbox-dns.com Name Server: sale460244.venus.orderbox-dns.com DNSSEC: Unsigned Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.2013775952 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-05-31T07:30:37Z