Formation-continue.ma
Formation Continue
Domain Summary
What is the traffic rank for Formation-continue.ma?
• Formation-continue.ma ranks #5,630,741 globally on HypeStat.
What percent of global Internet users visit Formation-continue.ma?
• 1.3E-6% of global Internet users visit Formation-continue.ma
How many people visit Formation-continue.ma each day?
• Formation-continue.ma receives approximately 64 visitors and 86 page impressions per day.
How much Formation-continue.ma can earn?
• Formation-continue.ma should earn about $0.35/day from advertising revenue.
What is Formation-continue.ma estimated value?
• Estimated value of Formation-continue.ma is $337.62.
What IP addresses does Formation-continue.ma resolve to?
• Formation-continue.ma resolves to the IP addresses 94.229.70.33.
Where are Formation-continue.ma servers located in?
• Formation-continue.ma has servers located in London, England, EC4R, United Kingdom.
formation-continue.ma Profile
![formation-continue.ma formation-continue.ma](https://hypestat.b-cdn.net/screenshot/f/o/r/m/formation-continue.ma.webp)
What technologies does formation-continue.ma use?
These are the technologies used at formation-continue.ma. formation-continue.ma has a total of 6 technologies installed in 7 different categories.formation-continue.ma Traffic Analysis
Formation-continue.ma is ranked #5,630,741 in the world. This website is viewed by an estimated 64 visitors daily, generating a total of 86 pageviews. This equates to about 1.9K monthly visitors. Formation-continue.ma traffic has decreased by 13.33% compared to last month.Daily Visitors64
30%
Monthly Visits1.9K
13.33%
Pages per Visit1.34
151%
Visit duration00:52
Bounce Rate54.94%
50%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 64
- Monthly Visits:
- 1,939
- Pages per Visit:
- 1.34
- Daily Pageviews:
- 86
- Avg. visit duration:
- 00:52
- Bounce rate:
- 54.94%
- Global Reach:
- 1.3E-6%
- Monthly Visits (SEMrush):
- 91
- Monthly Unique Visitors (SEMrush):
- 91
- Monthly Visits (SimilarWeb):
- 1,882
- HypeRank:
- 5,630,741
- SimilarWeb Rank:
- 6,467,340
Traffic sources
- Direct:
- 0%
- Referral:
- 100.00%
- Search:
- 0%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 100.00%
- Mobile:
- 0%
Total Visits Last 3 Months
2.1K
MAY
2.2K
JUN
1.9K
JUL
Backlinks Report ▼
Formation-continue.ma has a total of 537 backlinks from 79 referring domains and most of them comes from United States.- Total Backlinks:
- 537
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 79
- Referring IPs:
- 31
- Authority Domain Score:
- 7
Backlinks by country
- Country
- Domains
- United States 48
- Singapore 12
- France 3
- Germany 3
- Ukraine 2
Backlinks by TLDs
- TLD Distribution
- Domains
- .pw
- 29
- .com
- 17
- .in
- 10
- .edu
- 0
- .gov
- 0
Which sites are competitors to formation-continue.ma?
Websites similar to formation-continue.ma are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 299 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with formation-continue.ma in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Bing Index:
- 179
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- formation-continue.ma
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $0.4 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $10.5 and annual gross revenue of approximately $127.8. Based on these figures, the site's net worth is estimated at around $337.6.How much would formation-continue.ma make?
- Daily Revenue:
- $0.35
- Monthly Revenue:
- $10.50
- Yearly Revenue:
- $127.75
How much is formation-continue.ma worth?
- Website Value:
- $337.6
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- formation-continue.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- formation-continue.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- formation-continue.ma
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is formation-continue.ma hosted? ▼
Formation-continue.ma may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 94.229.70.33
- ASN:
- AS42831
- ISP:
- UK Dedicated Servers Limited
- Server Location:
- London
England, ENG
EC4R
United Kingdom, GB
Other sites hosted on 94.229.70.33
How fast does formation-continue.ma load? ▼
The average loading time of formation-continue.ma is 590 ms. The Desktop speed index is 98 and mobile speed index is 65.- Average Load Time:
- 590 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Lab Data
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
First Meaningful Paint 0.8 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Time to Interactive 0.8 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Total Blocking Time 0 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Speed Index 1.0 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Largest Contentful Paint 0.9 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
First Contentful Paint 0.8 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Max Potential First Input Delay 20 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Lab Data
First Contentful Paint 2.5 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
First Meaningful Paint 3.2 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Largest Contentful Paint 3.7 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Speed Index 3.8 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Max Potential First Input Delay 190 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Total Blocking Time 180 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Time to Interactive 4.8 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Does formation-continue.ma use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on formation-continue.ma are reduced by 74%.
formation-continue.ma use gzip compression.
Original size: 21.91 KB
Compressed size: 5.6 KB
File reduced by: 16.31 KB (74%)
Compressed size: 5.6 KB
File reduced by: 16.31 KB (74%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. formation-continue.ma supports HTTPS. formation-continue.ma supports HTTPS
Verifying SSL Support. Please wait...
Common Name: formation-continue.ma
Organization:
Location:
Issuer: R3
Valid from: Aug 24 00:09:41 2023 GMT
Valid until: Nov 22 00:09:40 2023 GMT
Authority: CA:FALSE
Keysize:
Organization:
Location:
Issuer: R3
Valid from: Aug 24 00:09:41 2023 GMT
Valid until: Nov 22 00:09:40 2023 GMT
Authority: CA:FALSE
Keysize:
Common Name: R3
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: ISRG Root X1
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. formation-continue.ma supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.x-powered-by: PHP/5.6.40
p3p: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"
cache-control: private, no-cache
pragma: no-cache
set-cookie: 464b4e8a8f8abbbd130e2aa1a2771752=69iisb77kq529e9g4bu0gtn800; path=/
set-cookie: ja_university_tpl=ja_university; expires=Fri, 16-Aug-2024 00:35:03 GMT; Max-Age=30672000; path=/
vary: Accept-Encoding,User-Agent
content-encoding: gzip
content-type: text/html; charset=utf-8
date: Sun, 27 Aug 2023 00:35:03 GMT
server: Apache
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 1800 | ||
Mname | dns1.lonex.com | ||
Rname | root.lonex.com | ||
Serial Number | 1677670268 | ||
Refresh | 28800 | ||
Retry | 7200 | ||
Expire | 604800 | ||
Minimum TTL | 86400 | ||
TXT | 3600 | ||
A | 94.229.70.33 | 1800 | |
MX | 1800 | ||
MX | 1800 | ||
NS | 1800 | ||
NS | 1800 | ||
NS | 1800 | ||
NS | 1800 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 17, 2013 and will expire on June 18, 2024 if not renewed. This website is now assigned through the registrar ARCANES TECHNOLOGIES. The WHOIS data for this website's domain was last updated on June 19, 2023.- Domain Created:
- 2013-06-17
- Domain Expires:
- 2024-06-18
- Domain Updated:
- 2023-06-19
- Domain Age:
- 11 years 4 days
- Domain Registrar:
- ARCANES TECHNOLOGIES
- Domain Owner:
- Mme Kamar Laghmich
- WhoIs:
Domain Name: formation-continue.ma Updated Date: 2023-06-19T10:54:04.508Z Creation Date: 2013-06-17T23:00:00.000Z Registry Expiry Date: 2024-06-18T00:00:00.000Z Sponsoring Registrar: ARCANES TECHNOLOGIES Domain Status: clientTransferProhibited Domain Status: ok Registrant Name: Mme Kamar Laghmich Admin Name: RIADI AMINE Admin Phone: +212.522491944 Admin Phone Ext: Admin Email:Tech Name: RIADI AMINE Tech Phone: +212.522491944 Tech Phone Ext: Tech Email:
Name Server: dns1.lonex.com Name Server: dns2.lonex.com Name Server: dns3.lonex.com Name Server: dns4.lonex.com >>> Last update of WHOIS database: 2023-08-27T00:35:58.106Z