Speakenglishwithtiffaniacademy.com
LET'S JUMP RIGHT IN! | Speak English With Tiffani AcademyDomain Summary
What is the traffic rank for Speakenglishwithtiffaniacademy.com?
• Speakenglishwithtiffaniacademy.com ranks #1,995,726 globally on HypeStat.
What percent of global Internet users visit Speakenglishwithtiffaniacademy.com?
• 3.21E-5% of global Internet users visit Speakenglishwithtiffaniacademy.com
How many people visit Speakenglishwithtiffaniacademy.com each day?
• Speakenglishwithtiffaniacademy.com receives approximately 1.6K visitors and 4,453 page impressions per day.
How much Speakenglishwithtiffaniacademy.com can earn?
• Speakenglishwithtiffaniacademy.com should earn about $18.17/day from advertising revenue.
What is Speakenglishwithtiffaniacademy.com estimated value?
• Estimated value of Speakenglishwithtiffaniacademy.com is $15,278.89.
What IP addresses does Speakenglishwithtiffaniacademy.com resolve to?
• Speakenglishwithtiffaniacademy.com resolves to the IP addresses 104.21.57.68.
speakenglishwithtiffaniacademy.com Profile
Title:LET'S JUMP RIGHT IN! | Speak English With Tiffani Academy
Category:Science and Education / Education
What technologies does speakenglishwithtiffaniacademy.com use?
These are the technologies used at speakenglishwithtiffaniacademy.com. speakenglishwithtiffaniacademy.com has a total of 10 technologies installed in 8 different categories.speakenglishwithtiffaniacademy.com Traffic Analysis
Speakenglishwithtiffaniacademy.com is ranked #1,995,726 in the world. This website is viewed by an estimated 1.6K visitors daily, generating a total of 4.5K pageviews. This equates to about 48K monthly visitors. Speakenglishwithtiffaniacademy.com traffic has increased by 12.31% compared to last month.Daily Visitors1.6K
14.19%
Monthly Visits48K
12.31%
Pages per Visit2.81
2.17%
Visit duration03:00
587.16%
Bounce Rate48.18%
2.28%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 1,583
- Monthly Visits:
- 47,965
- Pages per Visit:
- 2.81
- Daily Pageviews:
- 4,453
- Avg. visit duration:
- 03:00
- Bounce rate:
- 48.18%
- Global Reach:
- 3.21E-5%
- Monthly Visits (SEMrush):
- 22,600
- Monthly Unique Visitors (SEMrush):
- 11,509
- Monthly Visits (SimilarWeb):
- 47,012
- HypeRank:
- 1,995,726
- SEMrush Rank:
- 3,355,673
- SimilarWeb Rank:
- 746,801
Traffic sources
- Direct:
- 45.85%
- Referral:
- 7.81%
- Search:
- 0.79%
- Social:
- 45.55%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 16.57%
- Mobile:
- 83.43%
Total Visits Last 3 Months
33.4K
MAR
42.7K
APR
48K
MAY
Backlinks Report ▼
Speakenglishwithtiffaniacademy.com has a total of 2,291 backlinks from 235 referring domains and most of them comes from United States.- Total Backlinks:
- 2,291
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 235
- Referring IPs:
- 200
- Authority Domain Score:
- 9
Backlinks by country
- Country
- Domains
- United States 127
- Singapore 42
- France 12
- Germany 7
- Finland 4
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 86
- .in
- 34
- .pw
- 30
- .edu
- 0
- .gov
- 0
Last update was 360 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with speakenglishwithtiffaniacademy.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 782
- Bing Index:
- 520
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- speakenglishwithtiffaniacademy.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 3,355,673
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 167
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 94
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $86.00
Revenue report ▼
Google.com would generate approximately $18.2 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $545.1 and annual gross revenue of approximately $6.6K. Based on these figures, the site's net worth is estimated at around $15.3K.How much would speakenglishwithtiffaniacademy.com make?
- Daily Revenue:
- $18.17
- Monthly Revenue:
- $545.10
- Yearly Revenue:
- $6,632.05
How much is speakenglishwithtiffaniacademy.com worth?
- Website Value:
- $15.3K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- speakenglishwithtiffaniacademy.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- speakenglishwithtiffaniacademy.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- speakenglishwithtiffaniacademy.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is speakenglishwithtiffaniacademy.com hosted? ▼
Speakenglishwithtiffaniacademy.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 104.21.57.68
- ASN:
- AS13335
- ISP:
- Cloudflare Inc
- Server Location:
Other sites hosted on 104.21.57.68
How fast does speakenglishwithtiffaniacademy.com load? ▼
The average loading time of speakenglishwithtiffaniacademy.com is 216 ms.- Average Load Time:
- 216 ms
Does speakenglishwithtiffaniacademy.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on speakenglishwithtiffaniacademy.com are reduced by 75%.
speakenglishwithtiffaniacademy.com use br compression.
Original size: 31.15 KB
Compressed size: 7.58 KB
File reduced by: 23.56 KB (75%)
Compressed size: 7.58 KB
File reduced by: 23.56 KB (75%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. speakenglishwithtiffaniacademy.com supports HTTPS. speakenglishwithtiffaniacademy.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: speakenglishwithtiffaniacademy.com
Organization:
Location:
Issuer: GTS CA 1P5
Valid from: Jun 8 05:45:30 2023 GMT
Valid until: Sep 6 05:45:29 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: GTS CA 1P5
Valid from: Jun 8 05:45:30 2023 GMT
Valid until: Sep 6 05:45:29 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: GTS CA 1P5
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: GTS Root R1
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. speakenglishwithtiffaniacademy.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.date: Tue, 27 Jun 2023 15:00:03 GMT
content-type: text/html; charset=utf-8
x-fedora-school-id: 76970
cache-control: max-age=0, private, must-revalidate
set-cookie: ahoy_visitor=12fbf65f-b9b0-49c4-9ea2-ee6c24f2351b; path=/; expires=Fri, 27 Jun 2025 15:00:03 GMT; secure
x-request-id: 1076ac6b-4175-4dd7-a559-19c520e77e0c
x-runtime: 0.102574
strict-transport-security: max-age=0
x-frame-options: SAMEORIGIN
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
x-download-options: noopen
x-permitted-cross-domain-policies: none
referrer-policy: strict-origin-when-cross-origin
cf-cache-status: DYNAMIC
set-cookie: ahoy_visit=c123e75a-6292-4c48-8c65-53c751b29099; path=/; expires=Tue, 27 Jun 2023 19:00:03 GMT; secure
set-cookie: ahoy_track=true; path=/; secure
set-cookie: _afid=12fbf65f-b9b0-49c4-9ea2-ee6c24f2351b; domain=.speakenglishwithtiffaniacademy.com; path=/; expires=Thu, 27 Jun 2024 15:00:03 GMT; secure; SameSite=None
set-cookie: aid=12fbf65f-b9b0-49c4-9ea2-ee6c24f2351b; domain=.speakenglishwithtiffaniacademy.com; path=/; expires=Thu, 27 Jun 2024 15:00:03 GMT; secure; SameSite=None
set-cookie: site_preview=logged_out; path=/; secure
set-cookie: _session_id=3bd852ca1008aead93053716505982fa; path=/; expires=Thu, 27 Jul 2023 15:00:03 GMT; HttpOnly; secure
set-cookie: __cfruid=8a62de42888b87b9dbd767bdd9223bf4d496c670-1687878003; path=/; domain=.speakenglishwithtiffaniacademy.com; HttpOnly; Secure; SameSite=None
set-cookie: _cfuvid=oSrRvT_hrwfyRKt8pGQthNtIyoJOKbreN7aUyZXBBGQ-1687878003578-0-604800000; path=/; domain=.speakenglishwithtiffaniacademy.com; HttpOnly; Secure; SameSite=None
report-to: {"endpoints":[{"url":"https://a.nel.cloudflare.com/report/v3?s=m4t2adqKTr9rhogTYu19BA5Ym7VKIObNOvkPaqZ%2BhhhNNRNj1nIeJMVqr8wcsR90NJib7pqKEU23NVyOOs%2B4L%2FCTaxE%2FPuna0Cvueh6PfKxUZ61BUWgiM6wPO0YhF0kR6g%2BVYIOh3CXj%2FnNV8HzIjQUgSns3"}],"group":"cf-nel","max_age":604800}
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
cf-ray: 7dde8eb13e9d633c-ORD
content-encoding: br
alt-svc: h3=":443"; ma=86400
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
HINFO | 3600 | ||
A | 172.67.189.99 | 227 | |
A | 104.21.57.68 | 227 | |
NS | 3527 | ||
NS | 3527 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on December 4, 2018 and will expire on December 4, 2023 if not renewed. This website is now assigned through the registrar NAMECHEAP INC. The WHOIS data for this website's domain was last updated on November 4, 2022.- Domain Created:
- 2018-12-04
- Domain Expires:
- 2023-12-04
- Domain Updated:
- 2022-11-04
- Domain Age:
- 5 years 6 months 17 days
- Domain Registrar:
- NAMECHEAP INC
- Domain Owner:
- Privacy service provided by Withheld for Privacy e
- WhoIs:
Domain name: speakenglishwithtiffaniacademy.com Registry Domain ID: 2339788521_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 2022-11-04T07:41:46.57Z Creation Date: 2018-12-04T11:15:30.00Z Registrar Registration Expiration Date: 2023-12-04T11:15:30.00Z Registrar: NAMECHEAP INC Registrar IANA ID: 1068 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.9854014545 Reseller: NAMECHEAP INC Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: Redacted for Privacy Registrant Organization: Privacy service provided by Withheld for Privacy ehf Registrant Street: Kalkofnsvegur 2 Registrant City: Reykjavik Registrant State/Province: Capital Region Registrant Postal Code: 101 Registrant Country: IS Registrant Phone: +354.4212434 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Registry Admin ID: Admin Name: Redacted for Privacy Admin Organization: Privacy service provided by Withheld for Privacy ehf Admin Street: Kalkofnsvegur 2 Admin City: Reykjavik Admin State/Province: Capital Region Admin Postal Code: 101 Admin Country: IS Admin Phone: +354.4212434 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Registry Tech ID: Tech Name: Redacted for Privacy Tech Organization: Privacy service provided by Withheld for Privacy ehf Tech Street: Kalkofnsvegur 2 Tech City: Reykjavik Tech State/Province: Capital Region Tech Postal Code: 101 Tech Country: IS Tech Phone: +354.4212434 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Name Server: dilbert.ns.cloudflare.com Name Server: zara.ns.cloudflare.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-06-26T17:01:15.90Z