speakenglishwithtiffaniacademy.com Speakenglishwithtiffaniacademy.com

   
LET'S JUMP RIGHT IN! | Speak English With Tiffani Academy

Domain Summary

What is the traffic rank for Speakenglishwithtiffaniacademy.com?

• Speakenglishwithtiffaniacademy.com ranks #1,995,726 globally on HypeStat.

What percent of global Internet users visit Speakenglishwithtiffaniacademy.com?

3.21E-5% of global Internet users visit Speakenglishwithtiffaniacademy.com

How many people visit Speakenglishwithtiffaniacademy.com each day?

• Speakenglishwithtiffaniacademy.com receives approximately 1.6K visitors and 4,453 page impressions per day.

How much Speakenglishwithtiffaniacademy.com can earn?

• Speakenglishwithtiffaniacademy.com should earn about $18.17/day from advertising revenue.

What is Speakenglishwithtiffaniacademy.com estimated value?

• Estimated value of Speakenglishwithtiffaniacademy.com is $15,278.89.

What IP addresses does Speakenglishwithtiffaniacademy.com resolve to?

• Speakenglishwithtiffaniacademy.com resolves to the IP addresses 104.21.57.68.

speakenglishwithtiffaniacademy.com Profile

Title:LET'S JUMP RIGHT IN! | Speak English With Tiffani Academy
Category:Science and Education / Education

What technologies does speakenglishwithtiffaniacademy.com use?

These are the technologies used at speakenglishwithtiffaniacademy.com. speakenglishwithtiffaniacademy.com has a total of 10 technologies installed in 8 different categories.

speakenglishwithtiffaniacademy.com Traffic Analysis

Speakenglishwithtiffaniacademy.com is ranked #1,995,726 in the world. This website is viewed by an estimated 1.6K visitors daily, generating a total of 4.5K pageviews. This equates to about 48K monthly visitors. Speakenglishwithtiffaniacademy.com traffic has increased by 12.31% compared to last month.
Daily Visitors1.6K
14.19%
Monthly Visits48K
12.31%
Pages per Visit2.81
2.17%
Visit duration03:00
587.16%
Bounce Rate48.18%
2.28%
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
1,583
Monthly Visits:
47,965
Pages per Visit:
2.81
Daily Pageviews:
4,453
Avg. visit duration:
03:00
Bounce rate:
48.18%
Global Reach:
3.21E-5%
Monthly Visits (SEMrush):
22,600
Monthly Unique Visitors (SEMrush):
11,509
Monthly Visits (SimilarWeb):
47,012
HypeRank:
1,995,726
SEMrush Rank:
3,355,673
SimilarWeb Rank:
746,801
*All traffic values are estimates only.

Traffic sources

Direct:
45.85%
Referral:
7.81%
Search:
0.79%
Social:
45.55%
Paid:
0%

Desktop vs Mobile

Desktop:
16.57%
Mobile:
83.43%

Total Visits Last 3 Months

33.4K
MAR
42.7K
APR
48K
MAY
Last update was 360 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with speakenglishwithtiffaniacademy.com in any way. Only publicly available statistics data are displayed.

Search Engine Indexes

Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.
Google Index:
782
Bing Index:
520

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  speakenglishwithtiffaniacademy.com
Rank:
(Rank based on keywords, cost and organic traffic)
  3,355,673
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  167
Organic Traffic:
(Number of visitors coming from top 20 search results)
  94
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $86.00

Revenue report

Google.com would generate approximately $18.2 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $545.1 and annual gross revenue of approximately $6.6K. Based on these figures, the site's net worth is estimated at around $15.3K.

How much would speakenglishwithtiffaniacademy.com make?

Daily Revenue:
$18.17
Monthly Revenue:
$545.10
Yearly Revenue:
$6,632.05
*All earnings values are estimates only.

How much is speakenglishwithtiffaniacademy.com worth?

Website Value:
$15.3K

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
speakenglishwithtiffaniacademy.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
speakenglishwithtiffaniacademy.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
speakenglishwithtiffaniacademy.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is speakenglishwithtiffaniacademy.com hosted?

Speakenglishwithtiffaniacademy.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.

How fast does speakenglishwithtiffaniacademy.com load?

The average loading time of speakenglishwithtiffaniacademy.com is 216 ms.
Average Load Time:
216 ms

Does speakenglishwithtiffaniacademy.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on speakenglishwithtiffaniacademy.com are reduced by 75%.
speakenglishwithtiffaniacademy.com use br compression.
Original size: 31.15 KB
Compressed size: 7.58 KB
File reduced by: 23.56 KB (75%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

MyWot.com Reputation Ratings

MyWOT (short for "My Web of Trust") is a web-based reputation and rating service that provides users with information about the trustworthiness and safety of websites.
Status:
  UNKNOWN

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. speakenglishwithtiffaniacademy.com supports HTTPS.
 speakenglishwithtiffaniacademy.com supports HTTPS
     
Verifying SSL Support. Please wait...
Common Name: speakenglishwithtiffaniacademy.com
Organization:
Location:
Issuer: GTS CA 1P5
Valid from: Jun 8 05:45:30 2023 GMT
Valid until: Sep 6 05:45:29 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: GTS CA 1P5
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: GTS Root R1
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 speakenglishwithtiffaniacademy.com supports HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
date: Tue, 27 Jun 2023 15:00:03 GMT
content-type: text/html; charset=utf-8
x-fedora-school-id: 76970
cache-control: max-age=0, private, must-revalidate
set-cookie: ahoy_visitor=12fbf65f-b9b0-49c4-9ea2-ee6c24f2351b; path=/; expires=Fri, 27 Jun 2025 15:00:03 GMT; secure
x-request-id: 1076ac6b-4175-4dd7-a559-19c520e77e0c
x-runtime: 0.102574
strict-transport-security: max-age=0
x-frame-options: SAMEORIGIN
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
x-download-options: noopen
x-permitted-cross-domain-policies: none
referrer-policy: strict-origin-when-cross-origin
cf-cache-status: DYNAMIC
set-cookie: ahoy_visit=c123e75a-6292-4c48-8c65-53c751b29099; path=/; expires=Tue, 27 Jun 2023 19:00:03 GMT; secure
set-cookie: ahoy_track=true; path=/; secure
set-cookie: _afid=12fbf65f-b9b0-49c4-9ea2-ee6c24f2351b; domain=.speakenglishwithtiffaniacademy.com; path=/; expires=Thu, 27 Jun 2024 15:00:03 GMT; secure; SameSite=None
set-cookie: aid=12fbf65f-b9b0-49c4-9ea2-ee6c24f2351b; domain=.speakenglishwithtiffaniacademy.com; path=/; expires=Thu, 27 Jun 2024 15:00:03 GMT; secure; SameSite=None
set-cookie: site_preview=logged_out; path=/; secure
set-cookie: _session_id=3bd852ca1008aead93053716505982fa; path=/; expires=Thu, 27 Jul 2023 15:00:03 GMT; HttpOnly; secure
set-cookie: __cfruid=8a62de42888b87b9dbd767bdd9223bf4d496c670-1687878003; path=/; domain=.speakenglishwithtiffaniacademy.com; HttpOnly; Secure; SameSite=None
set-cookie: _cfuvid=oSrRvT_hrwfyRKt8pGQthNtIyoJOKbreN7aUyZXBBGQ-1687878003578-0-604800000; path=/; domain=.speakenglishwithtiffaniacademy.com; HttpOnly; Secure; SameSite=None
report-to: {"endpoints":[{"url":"https://a.nel.cloudflare.com/report/v3?s=m4t2adqKTr9rhogTYu19BA5Ym7VKIObNOvkPaqZ%2BhhhNNRNj1nIeJMVqr8wcsR90NJib7pqKEU23NVyOOs%2B4L%2FCTaxE%2FPuna0Cvueh6PfKxUZ61BUWgiM6wPO0YhF0kR6g%2BVYIOh3CXj%2FnNV8HzIjQUgSns3"}],"group":"cf-nel","max_age":604800}
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
cf-ray: 7dde8eb13e9d633c-ORD
content-encoding: br
alt-svc: h3=":443"; ma=86400

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
HINFO 3600
A 172.67.189.99 227
A 104.21.57.68 227
NS dilbert.ns.cloudflare.com 3527
NS zara.ns.cloudflare.com 3527

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on December 4, 2018 and will expire on December 4, 2023 if not renewed. This website is now assigned through the registrar NAMECHEAP INC. The WHOIS data for this website's domain was last updated on November 4, 2022.
Domain Created:
2018-12-04
Domain Expires:
2023-12-04
Domain Updated:
2022-11-04
Domain Age:
5 years 6 months 17 days
Domain Registrar:
NAMECHEAP INC
Domain Owner:
Privacy service provided by Withheld for Privacy e
WhoIs:
 

Domain name: speakenglishwithtiffaniacademy.com
Registry Domain ID: 2339788521_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2022-11-04T07:41:46.57Z
Creation Date: 2018-12-04T11:15:30.00Z
Registrar Registration Expiration Date: 2023-12-04T11:15:30.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: email
Registrar Abuse Contact Phone: +1.9854014545
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: 
Registrant Name: Redacted for Privacy
Registrant Organization: Privacy service provided by Withheld for Privacy ehf
Registrant Street: Kalkofnsvegur 2 
Registrant City: Reykjavik
Registrant State/Province: Capital Region
Registrant Postal Code: 101
Registrant Country: IS
Registrant Phone: +354.4212434
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: email
Registry Admin ID: 
Admin Name: Redacted for Privacy
Admin Organization: Privacy service provided by Withheld for Privacy ehf
Admin Street: Kalkofnsvegur 2 
Admin City: Reykjavik
Admin State/Province: Capital Region
Admin Postal Code: 101
Admin Country: IS
Admin Phone: +354.4212434
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: email
Registry Tech ID: 
Tech Name: Redacted for Privacy
Tech Organization: Privacy service provided by Withheld for Privacy ehf
Tech Street: Kalkofnsvegur 2 
Tech City: Reykjavik
Tech State/Province: Capital Region
Tech Postal Code: 101
Tech Country: IS
Tech Phone: +354.4212434
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: email
Name Server: dilbert.ns.cloudflare.com
Name Server: zara.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2023-06-26T17:01:15.90Z