Fsjes.ma
Inscription - Resultats - Cours - Exercices - Résumés - FSJES Maroc
Domain Summary
What is the traffic rank for Fsjes.ma?
• Fsjes.ma ranks #4,032,748 globally on HypeStat.
What percent of global Internet users visit Fsjes.ma?
• 3.05E-5% of global Internet users visit Fsjes.ma
How many people visit Fsjes.ma each day?
• Fsjes.ma receives approximately 1.5K visitors and 4,133 page impressions per day.
Which countries does Fsjes.ma receive most of its visitors from?
• Fsjes.ma is mostly visited by people located in Morocco.
How much Fsjes.ma can earn?
• Fsjes.ma should earn about $2.48/day from advertising revenue.
What is Fsjes.ma estimated value?
• Estimated value of Fsjes.ma is $2,251.76.
What IP addresses does Fsjes.ma resolve to?
• Fsjes.ma resolves to the IP addresses 2606:4700:3036::6815:4c97, 104.21.76.151.
fsjes.ma Profile

Title:Inscription - Resultats - Cours - Exercices - Résumés - FSJES Maroc
Description:Fsjes Maroc : Faculté des Sciences Juridiques Economiques et Sociales, Cours - Exercices - Résumés - Inscription et Resultats 2020-2021 (Bac, Licence, Master, Doctorat).
Category:Science and Education / Education
What technologies does fsjes.ma use?
These are the technologies used at fsjes.ma. fsjes.ma has a total of 14 technologies installed in 12 different categories.fsjes.ma Traffic Analysis
Fsjes.ma is ranked #4,032,748 in the world. This website is viewed by an estimated 1.5K visitors daily, generating a total of 4.1K pageviews. This equates to about 45.5K monthly visitors. Fsjes.ma traffic has increased by 2360.7% compared to last month.Daily Visitors1.5K
1061.45%
Monthly Visits45.5K
2360.7%
Pages per Visit2.75
70.23%
Visit duration02:19
84.24%
Bounce Rate56.51%
60.76%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 1,502
- Monthly Visits:
- 45,511
- Pages per Visit:
- 2.75
- Daily Pageviews:
- 4,133
- Avg. visit duration:
- 02:19
- Bounce rate:
- 56.51%
- Global Reach:
- 3.05E-5%
- Monthly Visits (SEMrush):
- 202,860
- Monthly Unique Visitors (SEMrush):
- 87,910
- Monthly Visits (SimilarWeb):
- 44,171
- HypeRank:
- 4,032,748
- SEMrush Rank:
- 32,019,985
- SimilarWeb Rank:
- 925,923
Traffic sources
- Direct:
- 32.83%
- Referral:
- 0.07%
- Search:
- 67.10%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 1.00%
- Mobile:
- 99.00%
Total Visits Last 3 Months
10.1K
JUL
1.8K
AUG
45.5K
SEP
Visitors by country
- Country
- Users%
- Morocco 100.00%
Backlinks Report ▼
Fsjes.ma has a total of 295 backlinks from 109 referring domains and most of them comes from United States.- Total Backlinks:
- 295
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 109
- Referring IPs:
- 81
- Authority Domain Score:
- 12
Backlinks by country
- Country
- Domains
- United States 49
- Singapore 28
- France 4
- Germany 3
- United Kingdom 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 43
- .in
- 25
- .dev
- 6
- .edu
- 0
- .gov
- 0
Which sites are competitors to fsjes.ma?
Websites similar to fsjes.ma are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 501 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with fsjes.ma in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 411
- Bing Index:
- 211
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- fsjes.ma
- Rank:
(Rank based on keywords, cost and organic traffic) - 32,019,985
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 5
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $2.5 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $74.4 and annual gross revenue of approximately $0.9K. Based on these figures, the site's net worth is estimated at around $2.3K.How much would fsjes.ma make?
- Daily Revenue:
- $2.48
- Monthly Revenue:
- $74.40
- Yearly Revenue:
- $905.20
Daily earning by country
- CountryPageviewsEarning
- Morocco 4,133$2.48
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.05
- Monthly Revenue Loss:
- $1.49
- Yearly Revenue Loss:
- $18.10
- Daily Pageviews Blocked:
- 83
- Monthly Pageviews Blocked:
- 2,480
- Yearly Pageviews Blocked:
- 30,171
Daily revenue loss by country
- CountryBlockedLost Money
- Morocco 83$0.05
How much is fsjes.ma worth?
- Website Value:
- $2.3K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- fsjes.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- fsjes.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- fsjes.ma
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is fsjes.ma hosted? ▼
Fsjes.ma may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 2606:4700:3036::6815:4c97, 104.21.76.151
- ASN:
- AS13335
- ISP:
- Cloudflare Inc
- Server Location:
Other sites hosted on 104.21.76.151
How fast does fsjes.ma load? ▼
The average loading time of fsjes.ma is 555 ms. The Desktop speed index is 81 and mobile speed index is 27.- Average Load Time:
- 555 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a FAST speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)9ms
Time To First Byte (TTFB)751ms
First Contentful Paint (FCP)1.7s
First Input Delay (FID)3ms
Interaction To Next Paint (INP)61ms
Largest Contentful Paint (LCP)1.9s
Origin Data
All pages served from this origin have an FAST speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)9ms
Time To First Byte (TTFB)751ms
First Contentful Paint (FCP)1.7s
First Input Delay (FID)3ms
Interaction To Next Paint (INP)61ms
Largest Contentful Paint (LCP)1.9s
Lab Data
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Time to Interactive 1.6 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
First Meaningful Paint 0.9 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Max Potential First Input Delay 80 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Largest Contentful Paint 1.9 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Speed Index 1.5 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Total Blocking Time 60 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
First Contentful Paint 0.8 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a SLOW speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)43ms
Time To First Byte (TTFB)1.2s
First Contentful Paint (FCP)2.3s
First Input Delay (FID)63ms
Interactive To Next Paint (INP)324ms
Largest Contentful Paint (LCP)3.5s
Origin Data
All pages served from this origin have an SLOW speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)31ms
Time To First Byte (TTFB)981ms
First Contentful Paint (FCP)1.9s
First Input Delay (FID)16ms
Interactive To Next Paint (INP)150ms
Largest Contentful Paint (LCP)2.1s
Lab Data
Speed Index 6.1 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
First Contentful Paint 2.6 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
Time to Interactive 8.1 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Largest Contentful Paint 6.0 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
First Meaningful Paint 2.8 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Total Blocking Time 1,030 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Max Potential First Input Delay 300 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Does fsjes.ma use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on fsjes.ma are reduced by 81%.
fsjes.ma use br compression.
Original size: 65.75 KB
Compressed size: 12.42 KB
File reduced by: 53.33 KB (81%)
Compressed size: 12.42 KB
File reduced by: 53.33 KB (81%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. fsjes.ma supports HTTPS. fsjes.ma supports HTTPS
Verifying SSL Support. Please wait...
Common Name: fsjes.ma
Organization:
Location:
Issuer: GTS CA 1P5
Valid from: Oct 16 21:51:40 2023 GMT
Valid until: Jan 14 21:51:39 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: GTS CA 1P5
Valid from: Oct 16 21:51:40 2023 GMT
Valid until: Jan 14 21:51:39 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: GTS CA 1P5
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: GTS Root R1
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. fsjes.ma supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.date: Tue, 31 Oct 2023 17:28:03 GMT
content-type: text/html; charset=UTF-8
x-powered-by: PHP/7.4.33
link: <https://fsjes.ma/wp-json/>; rel="https://api.w.org/"
link: <https://fsjes.ma/wp-json/wp/v2/pages/231>; rel="alternate"; type="application/json"
link: <https://fsjes.ma/>; rel=shortlink
vary: Accept-Encoding
cf-cache-status: DYNAMIC
report-to: {"endpoints":[{"url":"https://a.nel.cloudflare.com/report/v3?s=vWhvXkUgzhDTglZj1IMZMhCA%2BQDoI4LC8houYdmh78KFpyUl6yh4OHn%2FFU7uE%2FWv6JD0kxKpDT54RrXzk5w49IrRtOkeBOgdHbiJZm9wf1%2B3IZ1QdDFHpHlqvA%3D%3D"}],"group":"cf-nel","max_age":604800}
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
cf-ray: 81ed9cbcf8248102-ORD
content-encoding: br
alt-svc: h3=":443"; ma=86400
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
HINFO | 3600 | ||
AAAA | 2606:4700:3037::ac43:c442 | 223 | |
AAAA | 2606:4700:3036::6815:4c97 | 223 | |
A | 104.21.76.151 | 223 | |
A | 172.67.196.66 | 223 | |
NS | 107923 | ||
NS | 107923 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on November 13, 2017 and will expire on November 13, 2026 if not renewed. This website is now assigned through the registrar NAJA7HOST. The WHOIS data for this website's domain was last updated on October 16, 2023.- Domain Created:
- 2017-11-13
- Domain Expires:
- 2026-11-13
- Domain Updated:
- 2023-10-16
- Domain Age:
- 7 years 4 months 2 days
- Domain Registrar:
- NAJA7HOST
- Domain Owner:
- Zakariae Mhamzou
- WhoIs:
Domain Name: fsjes.ma Updated Date: 2023-10-16T22:31:36.259Z Creation Date: 2017-11-13T15:32:32.033Z Registry Expiry Date: 2026-11-13T15:32:32.124Z Sponsoring Registrar: NAJA7HOST Domain Status: ok Domain Status: clientTransferProhibited Registrant Name: Zakariae Mhamzou Admin Name: Zakariae Mhamzou Admin Phone: +212.674675984 Admin Phone Ext: Admin Email:Tech Name: Zakariae Mhamzou Tech Phone: +212.674675984 Tech Phone Ext: Tech Email:
Name Server: adrian.ns.cloudflare.com Name Server: jeff.ns.cloudflare.com >>> Last update of WHOIS database: 2023-10-31T17:26:05.814Z