Profsamad.com
Se préparer à l'examen régional - Prof Samad
Domain Summary
What is the traffic rank for Profsamad.com?
• Profsamad.com ranks #4,737,676 globally on HypeStat.
What percent of global Internet users visit Profsamad.com?
• 1.77E-5% of global Internet users visit Profsamad.com
How many people visit Profsamad.com each day?
• Profsamad.com receives approximately 872 visitors and 2,149 page impressions per day.
Which countries does Profsamad.com receive most of its visitors from?
• Profsamad.com is mostly visited by people located in Morocco.
How much Profsamad.com can earn?
• Profsamad.com should earn about $1.29/day from advertising revenue.
What is Profsamad.com estimated value?
• Estimated value of Profsamad.com is $1,160.59.
What IP addresses does Profsamad.com resolve to?
• Profsamad.com resolves to the IP addresses 23.229.174.8.
Where are Profsamad.com servers located in?
• Profsamad.com has servers located in United States.
profsamad.com Profile

Title:se préparer à l'examen régional - Prof Samad
Description:Si vous êtes en 1ère année du baccalauréat, vous aurez sûrement besoin de bien vous préparer pour l’examen régional, Prof Samad est là pour vous accompagner
Tags:
Category:Science and Education / Education
What technologies does profsamad.com use?
These are the technologies used at profsamad.com. profsamad.com has a total of 8 technologies installed in 10 different categories.profsamad.com Traffic Analysis
Profsamad.com is ranked #4,737,676 in the world. This website is viewed by an estimated 872 visitors daily, generating a total of 2.1K pageviews. This equates to about 26.4K monthly visitors. Profsamad.com traffic has increased by 533.29% compared to last month.Daily Visitors872
495.82%
Monthly Visits26.4K
533.29%
Pages per Visit2.46
2%
Visit duration03:40
Bounce Rate11.89%
1.56%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 872
- Monthly Visits:
- 26,422
- Pages per Visit:
- 2.46
- Daily Pageviews:
- 2,149
- Avg. visit duration:
- 03:40
- Bounce rate:
- 11.89%
- Global Reach:
- 1.77E-5%
- Monthly Visits (SEMrush):
- 27,111
- Monthly Unique Visitors (SEMrush):
- 25,507
- Monthly Visits (SimilarWeb):
- 26,424
- HypeRank:
- 4,737,676
- SEMrush Rank:
- 30,120,326
- SimilarWeb Rank:
- 1,475,870
Traffic sources
- Direct:
- 0%
- Referral:
- 0%
- Search:
- 100.00%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 5.72%
- Mobile:
- 94.28%
Total Visits Last 3 Months
5K
JUL
4.2K
AUG
26.4K
SEP
Visitors by country
- Country
- Users%
- Morocco 100.00%
Backlinks Report ▼
Profsamad.com has a total of 144 backlinks from 89 referring domains and most of them comes from United States.- Total Backlinks:
- 144
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 89
- Referring IPs:
- 75
- Authority Domain Score:
- 13
Backlinks by country
- Country
- Domains
- United States 36
- Singapore 19
- Netherlands 7
- France 6
- Turkey 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 43
- .in
- 16
- .org
- 5
- .edu
- 0
- .gov
- 0
Which sites are competitors to profsamad.com?
Websites similar to profsamad.com are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 501 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with profsamad.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 606
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- profsamad.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 30,120,326
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 13
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $1.3 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $38.7 and annual gross revenue of approximately $470.9. Based on these figures, the site's net worth is estimated at around $1.2K.How much would profsamad.com make?
- Daily Revenue:
- $1.29
- Monthly Revenue:
- $38.70
- Yearly Revenue:
- $470.85
Daily earning by country
- CountryPageviewsEarning
- Morocco 2,149$1.29
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.03
- Monthly Revenue Loss:
- $0.77
- Yearly Revenue Loss:
- $9.41
- Daily Pageviews Blocked:
- 43
- Monthly Pageviews Blocked:
- 1,289
- Yearly Pageviews Blocked:
- 15,688
Daily revenue loss by country
- CountryBlockedLost Money
- Morocco 43$0.03
How much is profsamad.com worth?
- Website Value:
- $1.2K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- profsamad.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- profsamad.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- profsamad.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is profsamad.com hosted? ▼
Profsamad.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 23.229.174.8
- ASN:
- AS398101
- ISP:
- GO-DADDY-COM-LLC
- Server Location:
United States, US
Other sites hosted on 23.229.174.8
How fast does profsamad.com load? ▼
The average loading time of profsamad.com is 2002 ms. The Desktop speed index is 68 and mobile speed index is 0.- Average Load Time:
- 2002 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Total Blocking Time 90 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
First Meaningful Paint 1.2 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Contentful Paint 1.2 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Time to Interactive 3.5 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Max Potential First Input Delay 120 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
Largest Contentful Paint 3.4 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Speed Index 2.6 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Does profsamad.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on profsamad.com are reduced by 83%.
profsamad.com use br compression.
Original size: 510.03 KB
Compressed size: 81.94 KB
File reduced by: 428.08 KB (83%)
Compressed size: 81.94 KB
File reduced by: 428.08 KB (83%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. profsamad.com supports HTTPS. profsamad.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: profsamad.com
Organization:
Location:
Issuer: profsamad.com
Valid from: Jan 30 14:33:35 2020 GMT
Valid until: Jan 29 14:33:35 2021 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: profsamad.com
Valid from: Jan 30 14:33:35 2020 GMT
Valid until: Jan 29 14:33:35 2021 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. profsamad.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.x-powered-by: PHP/7.4.33
link: <https://profsamad.com/wp-json/>; rel="https://api.w.org/", <https://profsamad.com/wp-json/wp/v2/pages/6>; rel="alternate"; type="application/json", <https://profsamad.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: br
content-length: 83911
content-type: text/html; charset=UTF-8
date: Wed, 01 Nov 2023 07:08:01 GMT
server: Apache
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
TXT | 3600 | ||
TXT | 3600 | ||
TXT | 3600 | ||
TXT | 3600 | ||
MX | 3600 | ||
SOA | 3600 | ||
Mname | ns05.domaincontrol.com | ||
Rname | dns.jomax.net | ||
Serial Number | 2020110403 | ||
Refresh | 28800 | ||
Retry | 7200 | ||
Expire | 604800 | ||
Minimum TTL | 600 | ||
A | 23.229.174.8 | 10721 | |
NS | 3600 | ||
NS | 3600 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on January 29, 2020 and will expire on January 29, 2024 if not renewed. This website is now assigned through the registrar GoDaddy.com, LLC. The WHOIS data for this website's domain was last updated on January 29, 2023.- Domain Created:
- 2020-01-29
- Domain Expires:
- 2024-01-29
- Domain Updated:
- 2023-01-29
- Domain Age:
- 5 years 1 months 18 days
- Domain Registrar:
- GoDaddy.com, LLC
- Domain Owner:
- Abdessamad Zine
- WhoIs:
Domain Name: profsamad.com Registry Domain ID: 2486298558_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: https://www.godaddy.com Updated Date: 2023-01-29T08:57:09Z Creation Date: 2020-01-29T16:24:06Z Registrar Registration Expiration Date: 2024-01-29T16:24:06Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Abdessamad Zine Registrant Organization: Registrant Street: Sidi maarouf Registrant City: Casablanca Registrant State/Province: Grand Casablanca Registrant Postal Code: 20000 Registrant Country: MA Registrant Phone: +212.602165973 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email:
Registry Admin ID: Not Available From Registry Admin Name: Abdessamad Zine Admin Organization: Admin Street: Sidi maarouf Admin City: Casablanca Admin State/Province: Grand Casablanca Admin Postal Code: 20000 Admin Country: MA Admin Phone: +212.602165973 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email:
Registry Tech ID: Not Available From Registry Tech Name: Abdessamad Zine Tech Organization: Tech Street: Sidi maarouf Tech City: Casablanca Tech State/Province: Grand Casablanca Tech Postal Code: 20000 Tech Country: MA Tech Phone: +212.602165973 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email:
Name Server: NS05.DOMAINCONTROL.COM Name Server: NS06.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-11-01T07:09:19Z