Tawassolapp.com
Tawassolapp
Domain Summary
What percent of global Internet users visit Tawassolapp.com?
• 7.2E-6% of global Internet users visit Tawassolapp.com
How many people visit Tawassolapp.com each day?
• Tawassolapp.com receives approximately 353 visitors and 723 page impressions per day.
Which countries does Tawassolapp.com receive most of its visitors from?
• Tawassolapp.com is mostly visited by people located in Morocco.
How much Tawassolapp.com can earn?
• Tawassolapp.com should earn about $0.43/day from advertising revenue.
What is Tawassolapp.com estimated value?
• Estimated value of Tawassolapp.com is $393.46.
What IP addresses does Tawassolapp.com resolve to?
• Tawassolapp.com resolves to the IP addresses 38.242.152.129.
Where are Tawassolapp.com servers located in?
• Tawassolapp.com has servers located in Diyarbakır, Diyarbakır Province, 21070, Türkiye.
tawassolapp.com Profile

What technologies does tawassolapp.com use?
These are the technologies used at tawassolapp.com. tawassolapp.com has a total of 3 technologies installed in 3 different categories.tawassolapp.com Traffic Analysis
This website is viewed by an estimated 353 visitors daily, generating a total of 723 pageviews. This equates to about 10.7K monthly visitors. Tawassolapp.com traffic has decreased by 19.77% compared to last month.Daily Visitors353
31.22%
Monthly Visits10.7K
19.77%
Pages per Visit2.05
27.01%
Visit duration00:19
6.79%
Bounce Rate62.24%
15.41%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 353
- Monthly Visits:
- 10,696
- Pages per Visit:
- 2.05
- Daily Pageviews:
- 723
- Avg. visit duration:
- 00:19
- Bounce rate:
- 62.24%
- Global Reach:
- 7.2E-6%
- Monthly Visits (SEMrush):
- 18,981
- Monthly Unique Visitors (SEMrush):
- 5,895
- Monthly Visits (SimilarWeb):
- 10,705
- HypeRank:
- n/a
- SEMrush Rank:
- 31,876,766
- SimilarWeb Rank:
- 2,160,415
Traffic sources
- Direct:
- 97.01%
- Referral:
- 0%
- Search:
- 0.67%
- Social:
- 1.39%
- Paid:
- 0.93%
Desktop vs Mobile
- Desktop:
- 35.45%
- Mobile:
- 64.55%
Total Visits Last 3 Months
4.9K
JAN
13.3K
FEB
10.7K
MAR
Visitors by country
- Country
- Users%
- Morocco 100.00%
Backlinks Report ▼
Tawassolapp.com has a total of 218 backlinks from 76 referring domains and most of them comes from Romania.- Total Backlinks:
- 218
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 76
- Referring IPs:
- 98
- Authority Domain Score:
- 27
Backlinks by country
- Country
- Domains
- Romania 6
- Russian Federation 5
- United States 5
- France 4
- Germany 2
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 20
- .info
- 8
- .dev
- 4
- .edu
- 0
- .gov
- 0
Which sites are competitors to tawassolapp.com?
Websites similar to tawassolapp.com are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- kezakoo.com
- Compare >11.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- 9rayti.com
- Compare >4K
- inscription.ma
- Compare >2.5K
- profpress.net
- Compare >2.2K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- albawaba.ma
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- dafatir.net
- Compare >628
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- capres.ca
- Compare >5
Last update was 54 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with tawassolapp.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 10
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- tawassolapp.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 31,876,766
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 1
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $0.4 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $12.9 and annual gross revenue of approximately $157. Based on these figures, the site's net worth is estimated at around $393.5.How much would tawassolapp.com make?
- Daily Revenue:
- $0.43
- Monthly Revenue:
- $12.90
- Yearly Revenue:
- $156.95
Daily earning by country
- CountryPageviewsEarning
- Morocco 723$0.43
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.01
- Monthly Revenue Loss:
- $0.26
- Yearly Revenue Loss:
- $3.17
- Daily Pageviews Blocked:
- 14
- Monthly Pageviews Blocked:
- 434
- Yearly Pageviews Blocked:
- 5,278
Daily revenue loss by country
- CountryBlockedLost Money
- Morocco 14$0.01
How much is tawassolapp.com worth?
- Website Value:
- $393.5
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- tawassolapp.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- tawassolapp.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- tawassolapp.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is tawassolapp.com hosted? ▼
Tawassolapp.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 38.242.152.129
- ASN:
- AS51167
- ISP:
- Contabo GmbH
- Server Location:
- Diyarbakır
Diyarbakır Province, 21
21070
Türkiye, TR
Other sites hosted on 38.242.152.129
There are no other sites hosted on this IPHow fast does tawassolapp.com load? ▼
The average loading time of tawassolapp.com is 337 ms. The Desktop speed index is 0 and mobile speed index is 83.- Average Load Time:
- 337 ms
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a AVERAGE speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0ms
Time To First Byte (TTFB)944ms
First Contentful Paint (FCP)1.9s
First Input Delay (FID)0
Interactive To Next Paint (INP)112ms
Largest Contentful Paint (LCP)2.4s
Origin Data
All pages served from this origin have an AVERAGE speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0ms
Time To First Byte (TTFB)902ms
First Contentful Paint (FCP)1.3s
First Input Delay (FID)0
Interactive To Next Paint (INP)149ms
Largest Contentful Paint (LCP)1.3s
Lab Data
Legacy JavaScript
Polyfills and transforms enable legacy browsers to use new JavaScript features. However, many aren't necessary for modern browsers. Consider modifying your JavaScript build process to not transpile features, unless you know you must support legacy browsers. Baseline Learn why most sites can deploy ES6+ code without transpiling
Polyfills and transforms enable legacy browsers to use new JavaScript features. However, many aren't necessary for modern browsers. Consider modifying your JavaScript build process to not transpile features, unless you know you must support legacy browsers. Baseline Learn why most sites can deploy ES6+ code without transpiling
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Largest Contentful Paint 4.6 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Time to Interactive 4.8 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
First Meaningful Paint
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Total Blocking Time 0 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Max Potential First Input Delay 20 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
INP by phase
Start investigating with the longest phase. To reduce processing duration, , often JS. Delays can be minimized optimize the main-thread costs
Start investigating with the longest phase. To reduce processing duration, , often JS. Delays can be minimized optimize the main-thread costs
Speed Index 2.7 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
First Contentful Paint 1.1 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Duplicated JavaScript
Remove large, duplicate JavaScript modules from bundles to reduce unnecessary bytes consumed by network activity.
Remove large, duplicate JavaScript modules from bundles to reduce unnecessary bytes consumed by network activity.
Does tawassolapp.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on tawassolapp.com are reduced by 79%.
tawassolapp.com use gzip compression.
Original size: 28.8 KB
Compressed size: 5.82 KB
File reduced by: 22.98 KB (79%)
Compressed size: 5.82 KB
File reduced by: 22.98 KB (79%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. tawassolapp.com supports HTTPS. tawassolapp.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: tawassolapp.com
Organization:
Location:
Issuer: E6
Valid from: Apr 15 20:46:42 2025 GMT
Valid until: Jul 14 20:46:41 2025 GMT
Authority: CA:FALSE
Keysize:
Organization:
Location:
Issuer: E6
Valid from: Apr 15 20:46:42 2025 GMT
Valid until: Jul 14 20:46:41 2025 GMT
Authority: CA:FALSE
Keysize:
Common Name: E6
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize:
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize:
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. tawassolapp.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.set-cookie: PHPSESSID=oavt9kns72rd9asudlm3ht8odf; path=/
expires: Thu, 19 Nov 1981 08:52:00 GMT
cache-control: no-store, no-cache, must-revalidate
pragma: no-cache
content-type: text/html; charset=UTF-8
content-encoding: gzip
vary: Accept-Encoding
content-length: 5960
date: Fri, 02 May 2025 23:32:02 GMT
server: LiteSpeed
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
MX | 86400 | ||
SOA | 86400 | ||
Mname | ns1.contabo.net | ||
Rname | hostmaster.contabo.com | ||
Serial Number | 2025041501 | ||
Refresh | 3600 | ||
Retry | 7200 | ||
Expire | 2419200 | ||
Minimum TTL | 10800 | ||
A | 38.242.152.129 | 86327 | |
NS | 86400 | ||
NS | 86400 | ||
NS | 86400 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 9, 2016 and will expire on June 9, 2029 if not renewed. This website is now assigned through the registrar Hostinger Operations, UAB. The WHOIS data for this website's domain was last updated on April 29, 2025.- Domain Created:
- 2016-06-09
- Domain Expires:
- 2029-06-09
- Domain Updated:
- 2025-04-29
- Domain Age:
- 9 years 17 days
- Domain Registrar:
- Hostinger Operations, UAB
- Domain Owner:
- Privacy Protect, LLC (PrivacyProtect.org)
- WhoIs:
Domain Name: TAWASSOLAPP.COM Registry Domain ID: 2034675348_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.hostinger.com Registrar URL: https://www.hostinger.com Updated Date: 2025-04-29T02:15:29Z Creation Date: 2016-06-09T17:32:19Z Registrar Registration Expiration Date: 2029-06-09T17:32:19Z Registrar: Hostinger Operations, UAB Registrar IANA ID: 1636 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Domain Admin Registrant Organization: Privacy Protect, LLC (PrivacyProtect.org) Registrant Street: 10 Corporate Drive Registrant City: Burlington Registrant State/Province: MA Registrant Postal Code: 01803 Registrant Country: US Registrant Phone: +1.8022274003 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email:Registry Admin ID: Not Available From Registry Admin Name: Domain Admin Admin Organization: Privacy Protect, LLC (PrivacyProtect.org) Admin Street: 10 Corporate Drive Admin City: Burlington Admin State/Province: MA Admin Postal Code: 01803 Admin Country: US Admin Phone: +1.8022274003 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email:
Registry Tech ID: Not Available From Registry Tech Name: Domain Admin Tech Organization: Privacy Protect, LLC (PrivacyProtect.org) Tech Street: 10 Corporate Drive Tech City: Burlington Tech State/Province: MA Tech Postal Code: 01803 Tech Country: US Tech Phone: +1.8022274003 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email:
Name Server: ns1.contabo.net Name Server: ns2.contabo.net Name Server: ns3.contabo.net DNSSEC: Unsigned Registrar Abuse Contact Email:
Registrar Abuse Contact Phone: +37064503378 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2025-05-02T23:33:13Z