Dafatir.net
Domain Summary
What is the traffic rank for Dafatir.net?
• Dafatir.net ranks #1,127,941 globally on HypeStat.
What percent of global Internet users visit Dafatir.net?
• 1.27E-5% of global Internet users visit Dafatir.net
How many people visit Dafatir.net each day?
• Dafatir.net receives approximately 628 visitors and 2,213 page impressions per day.
Which countries does Dafatir.net receive most of its visitors from?
• Dafatir.net is mostly visited by people located in Morocco,Algeria,Tunisia.
How much Dafatir.net can earn?
• Dafatir.net should earn about $1.12/day from advertising revenue.
What is Dafatir.net estimated value?
• Estimated value of Dafatir.net is $1,198.90.
What IP addresses does Dafatir.net resolve to?
• Dafatir.net resolves to the IP addresses 2606:4700:3030::6815:6001, 104.21.16.1.
Where are Dafatir.net servers located in?
• Dafatir.net has servers located in Chantilly, Virginia, 20151, United States.
dafatir.net Profile

About:
ÃÂãÃÂæÃÂÃÂÃÂàÃÂãÃÂÃÂÃÂÃÂÃÂãÃÂàÃÂÃÂÃÂáÃÂÃÂÃÂÃÂÃÂÃÂÃÂÃÂÃÂàÃÂæ ÃÂÃÂÃÂáÃÂÃÂÃÂÃÂÃÂáÃÂÃÂÃÂã ÃÂÃÂÃÂÃÂÃÂáÃÂãÃÂÃÂÃÂÃÂÃÂÃÂ
Edit Site Info
What technologies does dafatir.net use?
These are the technologies used at dafatir.net. dafatir.net has a total of 2 technologies installed in 2 different categories.dafatir.net Traffic Analysis
Dafatir.net is ranked #1,127,941 in the world. This website is viewed by an estimated 628 visitors daily, generating a total of 2.2K pageviews. This equates to about 19K monthly visitors. Dafatir.net traffic has decreased by 53.18% compared to last month.Daily Visitors628
30.9%
Monthly Visits19K
53.18%
Pages per Visit3.52
14.24%
Visit duration02:11
510.14%
Bounce Rate40.72%
7.17%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 628
- Monthly Visits:
- 19,028
- Pages per Visit:
- 3.52
- Daily Pageviews:
- 2,213
- Avg. visit duration:
- 02:11
- Bounce rate:
- 40.72%
- Global Reach:
- 1.27E-5%
- Monthly Visits (SEMrush):
- 12,648
- Monthly Unique Visitors (SEMrush):
- 9,233
- Monthly Visits (SimilarWeb):
- 18,653
- HypeRank:
- 1,127,941
- SEMrush Rank:
- 8,313,735
- SimilarWeb Rank:
- 1,204,590
Traffic sources
- Direct:
- 75.00%
- Referral:
- 0.94%
- Search:
- 23.43%
- Social:
- 0%
- Paid:
- 0.63%
Desktop vs Mobile
- Desktop:
- 28.74%
- Mobile:
- 71.26%
Total Visits Last 3 Months
25.9K
DEC
40.6K
JAN
19K
FEB
Where do visitors go on dafatir.net?
- Reach%Pageviews%PerUser
- dafatir.net
- 100.00%100.00%2.3
Backlinks Report ▼
Dafatir.net has a total of 802 backlinks from 305 referring domains and most of them comes from Singapore.- Total Backlinks:
- 802
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 305
- Referring IPs:
- 169
- Authority Domain Score:
- 29
Backlinks by country
- Country
- Domains
- Singapore 169
- United States 19
- Germany 3
- Romania 3
- Netherlands 3
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 145
- .in
- 43
- .top
- 24
- .edu
- 0
- .gov
- 0
Which sites are competitors to dafatir.net?
Websites similar to dafatir.net are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- kezakoo.com
- Compare >11.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- 9rayti.com
- Compare >4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- albawaba.ma
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- capres.ca
- Compare >5
Last update was 95 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with dafatir.net in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 287,000
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- dafatir.net
- Rank:
(Rank based on keywords, cost and organic traffic) - 8,313,735
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 9
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 7
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $1.1 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $33.6 and annual gross revenue of approximately $408.8. Based on these figures, the site's net worth is estimated at around $1.2K.How much would dafatir.net make?
- Daily Revenue:
- $1.12
- Monthly Revenue:
- $33.60
- Yearly Revenue:
- $408.80
Daily earning by country
- CountryPageviewsEarning
- Morocco 1,602$0.96
- Algeria 220$0.11
- Tunisia 213$0.03
- Egypt 178$0.02
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.03
- Monthly Revenue Loss:
- $0.79
- Yearly Revenue Loss:
- $9.66
- Daily Pageviews Blocked:
- 56
- Monthly Pageviews Blocked:
- 1,686
- Yearly Pageviews Blocked:
- 20,514
Daily revenue loss by country
- CountryBlockedLost Money
- Morocco 32$0.02
- Algeria 11$0.01
- Egypt 9$0.00
- Tunisia 4$0.00
How much is dafatir.net worth?
- Website Value:
- $1.2K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- dafatir.net
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- dafatir.net
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- dafatir.net
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is dafatir.net hosted? ▼
Dafatir.net may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 2606:4700:3030::6815:6001, 104.21.16.1
- ASN:
- AS13335
- ISP:
- Cloudflare Inc
- Server Location:
- Chantilly
Virginia, VA
20151
United States, US
Other sites hosted on 104.21.16.1
How fast does dafatir.net load? ▼
The average loading time of dafatir.net is 80 ms. The Desktop speed index is 80 and mobile speed index is 89.- Average Load Time:
- 80 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Does dafatir.net use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on dafatir.net are reduced by 69%.
dafatir.net use br compression.
Original size: 2.91 KB
Compressed size: 920 B
File reduced by: 2.01 KB (69%)
Compressed size: 920 B
File reduced by: 2.01 KB (69%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. dafatir.net supports HTTPS. dafatir.net supports HTTPS
Verifying SSL Support. Please wait...
Common Name: dafatir.net
Organization:
Location:
Issuer: WE1
Valid from: Jan 27 12:57:43 2025 GMT
Valid until: Apr 27 13:56:16 2025 GMT
Authority: CA:FALSE
Keysize:
Organization:
Location:
Issuer: WE1
Valid from: Jan 27 12:57:43 2025 GMT
Valid until: Apr 27 13:56:16 2025 GMT
Authority: CA:FALSE
Keysize:
Common Name: WE1
Organization: Google Trust Services
Location: US
Issuer: GTS Root R4
Valid from: Dec 13 09:00:00 2023 GMT
Valid until: Feb 20 14:00:00 2029 GMT
Authority: CA:TRUE
Keysize:
Organization: Google Trust Services
Location: US
Issuer: GTS Root R4
Valid from: Dec 13 09:00:00 2023 GMT
Valid until: Feb 20 14:00:00 2029 GMT
Authority: CA:TRUE
Keysize:
Common Name: GTS Root R4
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Nov 15 03:43:21 2023 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize:
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Nov 15 03:43:21 2023 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize:
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. dafatir.net supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.date: Fri, 21 Mar 2025 10:49:27 GMT
content-type: text/html
last-modified: Sun, 11 Oct 2020 19:52:06 GMT
vary: Accept-Encoding,User-Agent
cf-cache-status: DYNAMIC
report-to: {"endpoints":[{"url":"https://a.nel.cloudflare.com/report/v4?s=DFwFShqaEeRlVdbiHSpv2TWTmwENbd6TJX4nFJio1vyYX9%2BAgrS%2FvVQjclYYXwsFraSe43MXEPXqXaJUmCaguneiAwCFdPEwy2xllFHgz30vE2nAd6U8lK68wy49%2Bw%3D%3D"}],"group":"cf-nel","max_age":604800}
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
cf-ray: 923ce1fb3bbeeb65-ORD
content-encoding: br
alt-svc: h3=":443"; ma=86400
server-timing: cfL4;desc="?proto=TCP&rtt=7343&min_rtt=2123&rtt_var=10873&sent=8&recv=11&lost=0&retrans=0&sent_bytes=3410&recv_bytes=891&delivery_rate=1327222&cwnd=230&unsent_bytes=0&cid=95f2cae813a9c84a&ts=74&x=0"
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
AAAA | 2606:4700:3030::6815:7001 | 245 | |
AAAA | 2606:4700:3030::6815:5001 | 245 | |
AAAA | 2606:4700:3030::6815:2001 | 245 | |
AAAA | 2606:4700:3030::6815:3001 | 245 | |
AAAA | 2606:4700:3030::6815:4001 | 245 | |
AAAA | 2606:4700:3030::6815:1001 | 245 | |
AAAA | 2606:4700:3030::6815:6001 | 245 | |
A | 104.21.96.1 | 245 | |
A | 104.21.16.1 | 245 | |
A | 104.21.80.1 | 245 | |
A | 104.21.64.1 | 245 | |
A | 104.21.32.1 | 245 | |
A | 104.21.48.1 | 245 | |
A | 104.21.112.1 | 245 | |
NS | 172745 | ||
NS | 172745 | ||
HINFO | 3600 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 20, 2007 and will expire on June 20, 2025 if not renewed. This website is now assigned through the registrar ENOM, INC.. The WHOIS data for this website's domain was last updated on June 22, 2024.- Domain Created:
- 2007-06-20
- Domain Expires:
- 2025-06-20
- Domain Updated:
- 2024-06-22
- Domain Age:
- 18 years 4 days
- Domain Registrar:
- ENOM, INC.
- Domain Owner:
- REDACTED FOR PRIVACY
- WhoIs:
Domain Name: dafatir.net Registry Domain ID: 1039030160_DOMAIN_NET-VRSN Registrar WHOIS Server: WHOIS.ENOM.COM Registrar URL: WWW.ENOMDOMAINS.COM Updated Date: 2024-06-22T13:15:33.00Z Creation Date: 2007-06-20T12:36:00.00Z Registrar Registration Expiration Date: 2025-06-20T12:36:40.00Z Registrar: ENOM, INC. Registrar IANA ID: 48 Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registrant Name: REDACTED FOR PRIVACY Registrant Organization: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant Street: Registrant City: REDACTED FOR PRIVACY Registrant State/Province: CASABLANCA Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: MA Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: Registrant Fax: REDACTED FOR PRIVACY Registrant Email: https://tieredaccess.com/contact/6f7c64dd-c5ef-43ce-a3ab-29e512a319af Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin Street: Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: Admin Fax: REDACTED FOR PRIVACY Admin Email: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech Street: Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: Tech Fax: REDACTED FOR PRIVACY Tech Email: REDACTED FOR PRIVACY Name Server: BOB.NS.CLOUDFLARE.COM Name Server: GINA.NS.CLOUDFLARE.COM DNSSEC: unsigned Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.4259744689 URL of the ICANN WHOIS Data Problem Reporting System: HTTPS://ICANN.ORG/WICF >>> Last update of WHOIS database: 2025-03-21T10:50:21.00Z