Pakistanihealthyrecipes.com
Pakistani Food Blog With Easy Healthy RecipesDomain Summary
What is the traffic rank for Pakistanihealthyrecipes.com?
• Pakistanihealthyrecipes.com ranks #4,906,256 globally on HypeStat.
What percent of global Internet users visit Pakistanihealthyrecipes.com?
• 3.2E-5% of global Internet users visit Pakistanihealthyrecipes.com
How many people visit Pakistanihealthyrecipes.com each day?
• Pakistanihealthyrecipes.com receives approximately 1.6K visitors and 2,291 page impressions per day.
Which countries does Pakistanihealthyrecipes.com receive most of its visitors from?
• Pakistanihealthyrecipes.com is mostly visited by people located in Pakistan,United States,Netherlands.
How much Pakistanihealthyrecipes.com can earn?
• Pakistanihealthyrecipes.com should earn about $1.07/day from advertising revenue.
What is Pakistanihealthyrecipes.com estimated value?
• Estimated value of Pakistanihealthyrecipes.com is $868.20.
What IP addresses does Pakistanihealthyrecipes.com resolve to?
• Pakistanihealthyrecipes.com resolves to the IP addresses 108.179.232.86.
Where are Pakistanihealthyrecipes.com servers located in?
• Pakistanihealthyrecipes.com has servers located in United States.
pakistanihealthyrecipes.com Profile
Title:Pakistani Food Blog With Easy Healthy Recipes
Description:A Pakistani food blog on simple and easy healthy recipes. Discover a huge collection of wholesome recipes of different cuisines around the world.
Category:Computers Electronics and Technology / Social Media Networks
What technologies does pakistanihealthyrecipes.com use?
These are the technologies used at pakistanihealthyrecipes.com. pakistanihealthyrecipes.com has a total of 15 technologies installed in 13 different categories.pakistanihealthyrecipes.com Traffic Analysis
Pakistanihealthyrecipes.com is ranked #4,906,256 in the world. This website is viewed by an estimated 1.6K visitors daily, generating a total of 2.3K pageviews. This equates to about 47.9K monthly visitors. Pakistanihealthyrecipes.com traffic has increased by 139.88% compared to last month.Daily Visitors1.6K
148.76%
Monthly Visits47.9K
139.88%
Pages per Visit1.45
11.89%
Visit duration02:30
1106%
Bounce Rate71.92%
6.91%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 1,580
- Monthly Visits:
- 47,874
- Pages per Visit:
- 1.45
- Daily Pageviews:
- 2,291
- Avg. visit duration:
- 02:30
- Bounce rate:
- 71.92%
- Global Reach:
- 3.2E-5%
- Monthly Visits (SEMrush):
- 25,204
- Monthly Unique Visitors (SEMrush):
- 24,699
- Monthly Visits (SimilarWeb):
- 46,923
- HypeRank:
- 4,906,256
- SEMrush Rank:
- 1,052,346
- SimilarWeb Rank:
- 1,186,994
Traffic sources
- Direct:
- 0.80%
- Referral:
- 0.80%
- Search:
- 98.40%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 50.91%
- Mobile:
- 49.09%
Total Visits Last 3 Months
28K
MAR
20K
APR
47.9K
MAY
Visitors by country
- Country
- Users%
- Pakistan 89.64%
- United States 3.98%
- Netherlands 1.68%
- Brazil 1.46%
- India 1.14%
Backlinks Report ▼
Pakistanihealthyrecipes.com has a total of 384 backlinks from 121 referring domains and most of them comes from Singapore.- Total Backlinks:
- 384
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 121
- Referring IPs:
- 46
- Authority Domain Score:
- 30
Backlinks by country
- Country
- Domains
- Singapore 50
- United States 49
- Austria 3
- Netherlands 2
- Russian Federation 2
Backlinks by TLDs
- TLD Distribution
- Domains
- .in
- 44
- .com
- 30
- .pw
- 24
- .edu
- 0
- .gov
- 0
Last update was 322 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with pakistanihealthyrecipes.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 645
- Bing Index:
- 647
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- pakistanihealthyrecipes.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 1,052,346
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 9,684
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 795
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $42.00
Revenue report ▼
Google.com would generate approximately $1.1 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $32.1 and annual gross revenue of approximately $390.6. Based on these figures, the site's net worth is estimated at around $868.2.How much would pakistanihealthyrecipes.com make?
- Daily Revenue:
- $1.07
- Monthly Revenue:
- $32.10
- Yearly Revenue:
- $390.55
Daily earning by country
- CountryPageviewsEarning
- United States 91$0.44
- Pakistan 2,054$0.31
- Netherlands 38$0.07
- Brazil 33$0.04
- India 26$0.01
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.20
- Monthly Revenue Loss:
- $5.87
- Yearly Revenue Loss:
- $71.46
- Daily Pageviews Blocked:
- 689
- Monthly Pageviews Blocked:
- 20,684
- Yearly Pageviews Blocked:
- 251,652
Daily revenue loss by country
- CountryBlockedLost Money
- Pakistan 657$0.10
- United States 16$0.08
- Netherlands 7$0.01
- India 7$0.00
- Brazil 2$0.00
How much is pakistanihealthyrecipes.com worth?
- Website Value:
- $868.2
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- pakistanihealthyrecipes.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- pakistanihealthyrecipes.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- pakistanihealthyrecipes.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is pakistanihealthyrecipes.com hosted? ▼
Pakistanihealthyrecipes.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 108.179.232.86
- ASN:
- AS19871
- ISP:
- Network Solutions, LLC
- Server Location:
United States, US
Other sites hosted on 108.179.232.86
There are no other sites hosted on this IPHow fast does pakistanihealthyrecipes.com load? ▼
The average loading time of pakistanihealthyrecipes.com is 1389 ms.- Average Load Time:
- 1389 ms
Does pakistanihealthyrecipes.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on pakistanihealthyrecipes.com are reduced by 72%.
pakistanihealthyrecipes.com use gzip compression.
Original size: 138.5 KB
Compressed size: 37.72 KB
File reduced by: 100.78 KB (72%)
Compressed size: 37.72 KB
File reduced by: 100.78 KB (72%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. pakistanihealthyrecipes.com supports HTTPS. pakistanihealthyrecipes.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: pakistanihealthyrecipes.scamfraud.info
Organization:
Location:
Issuer: R3
Valid from: May 2 15:22:38 2023 GMT
Valid until: Jul 31 15:22:37 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R3
Valid from: May 2 15:22:38 2023 GMT
Valid until: Jul 31 15:22:37 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R3
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: ISRG Root X1
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. pakistanihealthyrecipes.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.x-redirect-by: WordPress
location: https://www.pakistanihealthyrecipes.com/
content-length: 0
content-type: text/html; charset=UTF-8
date: Fri, 09 Jun 2023 13:42:02 GMT
server: Apache
HTTP/2 200
link: <https://www.pakistanihealthyrecipes.com/wp-json/>; rel="https://api.w.org/"
vary: Accept-Encoding
content-encoding: gzip
content-type: text/html; charset=UTF-8
date: Fri, 09 Jun 2023 13:42:02 GMT
server: Apache
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 3600 | ||
Mname | ns8481.hostgator.com | ||
Rname | root.gator4241.hostgator.com | ||
Serial Number | 2023050201 | ||
Refresh | 86400 | ||
Retry | 7200 | ||
Expire | 3600000 | ||
Minimum TTL | 86400 | ||
MX | 3600 | ||
TXT | 3600 | ||
A | 108.179.232.86 | 3596 | |
NS | 3596 | ||
NS | 3596 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on March 20, 2021 and will expire on March 20, 2024 if not renewed. This website is now assigned through the registrar GoDaddy.com, LLC. The WHOIS data for this website's domain was last updated on February 7, 2022.- Domain Created:
- 2021-03-20
- Domain Expires:
- 2024-03-20
- Domain Updated:
- 2022-02-07
- Domain Age:
- 3 years 1 months 6 days
- Domain Registrar:
- GoDaddy.com, LLC
- Domain Owner:
- Domains By Proxy, LLC
- WhoIs:
Domain Name: pakistanihealthyrecipes.com Registry Domain ID: 2599444296_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: https://www.godaddy.com Updated Date: 2022-02-07T05:52:31Z Creation Date: 2021-03-21T03:10:49Z Registrar Registration Expiration Date: 2024-03-21T03:10:49Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Registrant Street: DomainsByProxy.com Registrant Street: 2155 E Warner Rd Registrant City: Tempe Registrant State/Province: Arizona Registrant Postal Code: 85284 Registrant Country: US Registrant Phone: +1.4806242599 Registrant Phone Ext: Registrant Fax: +1.4806242598 Registrant Fax Ext: Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=pakistanihealthyrecipes.com Registry Admin ID: Not Available From Registry Admin Name: Registration Private Admin Organization: Domains By Proxy, LLC Admin Street: DomainsByProxy.com Admin Street: 2155 E Warner Rd Admin City: Tempe Admin State/Province: Arizona Admin Postal Code: 85284 Admin Country: US Admin Phone: +1.4806242599 Admin Phone Ext: Admin Fax: +1.4806242598 Admin Fax Ext: Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=pakistanihealthyrecipes.com Registry Tech ID: Not Available From Registry Tech Name: Registration Private Tech Organization: Domains By Proxy, LLC Tech Street: DomainsByProxy.com Tech Street: 2155 E Warner Rd Tech City: Tempe Tech State/Province: Arizona Tech Postal Code: 85284 Tech Country: US Tech Phone: +1.4806242599 Tech Phone Ext: Tech Fax: +1.4806242598 Tech Fax Ext: Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=pakistanihealthyrecipes.com Name Server: NS8481.HOSTGATOR.COM Name Server: NS8482.HOSTGATOR.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-06-08T07:12:21Z