Blogspot.com - Tugasfisikacahayatampakanistasyalaia.blogspot.com
Cahaya Tampak
Domain Summary
What IP addresses does Tugasfisikacahayatampakanistasyalaia.blogspot.com resolve to?
• Tugasfisikacahayatampakanistasyalaia.blogspot.com resolves to the IP addresses 216.58.192.193.
Where are Tugasfisikacahayatampakanistasyalaia.blogspot.com servers located in?
• Tugasfisikacahayatampakanistasyalaia.blogspot.com has servers located in Draper, Utah, 84020, United States.
tugasfisikacahayatampakanistasyalaia.blogspot.com Profile
Title:Cahaya Tampak
What technologies does tugasfisikacahayatampakanistasyalaia.blogspot.com use?
These are the technologies used at tugasfisikacahayatampakanistasyalaia.blogspot.com. tugasfisikacahayatampakanistasyalaia.blogspot.com has a total of 9 technologies installed in 7 different categories.tugasfisikacahayatampakanistasyalaia.blogspot.com Traffic Analysis
There's no enough data about tugasfisikacahayatampakanistasyalaia.blogspot.com traffic.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- n/a
Last update was 2024 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with blogspot.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- tugasfisikacahayatampakanistasyalaia.blogspot.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- blogspot.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- blogspot.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- blogspot.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is tugasfisikacahayatampakanistasyalaia.blogspot.com hosted? ▼
Tugasfisikacahayatampakanistasyalaia.blogspot.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 216.58.192.193
- ASN:
- AS15169
- ISP:
- Google LLC
- Server Location:
- Draper
Utah, UT
84020
United States, US
Other sites hosted on 216.58.192.193
How fast does tugasfisikacahayatampakanistasyalaia.blogspot.com load? ▼
The average loading time of tugasfisikacahayatampakanistasyalaia.blogspot.com is n/a ms. The Desktop speed index is 100 and mobile speed index is 99.- Average Load Time:
- n/a ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more
First Meaningful Paint 0.5 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more
First Meaningful Paint measures when the primary content of a page is visible. Learn more
Max Potential First Input Delay 40 ms
The maximum potential First Input Delay that your users could experience is the duration, in milliseconds, of the longest task. Learn more
The maximum potential First Input Delay that your users could experience is the duration, in milliseconds, of the longest task. Learn more
Time to Interactive 0.5 s
Time to interactive is the amount of time it takes for the page to become fully interactive. Learn more
Time to interactive is the amount of time it takes for the page to become fully interactive. Learn more
Total Blocking Time 0 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds.
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds.
Estimated Input Latency 10 ms
Estimated Input Latency is an estimate of how long your app takes to respond to user input, in milliseconds, during the busiest 5s window of page load. If your latency is higher than 50 ms, users may perceive your app as laggy. Learn more
Estimated Input Latency is an estimate of how long your app takes to respond to user input, in milliseconds, during the busiest 5s window of page load. If your latency is higher than 50 ms, users may perceive your app as laggy. Learn more
Speed Index 0.5 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more
Speed Index shows how quickly the contents of a page are visibly populated. Learn more
First CPU Idle 0.5 s
First CPU Idle marks the first time at which the page's main thread is quiet enough to handle input. Learn more
First CPU Idle marks the first time at which the page's main thread is quiet enough to handle input. Learn more
First Contentful Paint 0.5 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more
First Contentful Paint marks the time at which the first text or image is painted. Learn more
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more
First Meaningful Paint 1.6 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more
First Meaningful Paint measures when the primary content of a page is visible. Learn more
Max Potential First Input Delay 90 ms
The maximum potential First Input Delay that your users could experience is the duration, in milliseconds, of the longest task. Learn more
The maximum potential First Input Delay that your users could experience is the duration, in milliseconds, of the longest task. Learn more
Time to Interactive 2.3 s
Time to interactive is the amount of time it takes for the page to become fully interactive. Learn more
Time to interactive is the amount of time it takes for the page to become fully interactive. Learn more
First Contentful Paint (3G) 3090 ms
First Contentful Paint 3G marks the time at which the first text or image is painted while on a 3G network. Learn more
First Contentful Paint 3G marks the time at which the first text or image is painted while on a 3G network. Learn more
Total Blocking Time 20 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds.
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds.
Estimated Input Latency 10 ms
Estimated Input Latency is an estimate of how long your app takes to respond to user input, in milliseconds, during the busiest 5s window of page load. If your latency is higher than 50 ms, users may perceive your app as laggy. Learn more
Estimated Input Latency is an estimate of how long your app takes to respond to user input, in milliseconds, during the busiest 5s window of page load. If your latency is higher than 50 ms, users may perceive your app as laggy. Learn more
Speed Index 1.6 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more
Speed Index shows how quickly the contents of a page are visibly populated. Learn more
First CPU Idle 2.1 s
First CPU Idle marks the first time at which the page's main thread is quiet enough to handle input. Learn more
First CPU Idle marks the first time at which the page's main thread is quiet enough to handle input. Learn more
First Contentful Paint 1.6 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more
First Contentful Paint marks the time at which the first text or image is painted. Learn more
Does tugasfisikacahayatampakanistasyalaia.blogspot.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on tugasfisikacahayatampakanistasyalaia.blogspot.com are reduced by 78%.
tugasfisikacahayatampakanistasyalaia.blogspot.com use gzip compression.
Original size: 63.48 KB
Compressed size: 13.67 KB
File reduced by: 49.81 KB (78%)
Compressed size: 13.67 KB
File reduced by: 49.81 KB (78%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. tugasfisikacahayatampakanistasyalaia.blogspot.com supports HTTPS. tugasfisikacahayatampakanistasyalaia.blogspot.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: *.googleusercontent.com
Organization: Google LLC
Location: Mountain View, California, US
Issuer: GTS CA 1O1
Valid from: Aug 23 10:29:10 2019 GMT
Valid until: Nov 21 10:29:10 2019 GMT
Authority: Is not a CA
Keysize:
Organization: Google LLC
Location: Mountain View, California, US
Issuer: GTS CA 1O1
Valid from: Aug 23 10:29:10 2019 GMT
Valid until: Nov 21 10:29:10 2019 GMT
Authority: Is not a CA
Keysize:
Common Name: GTS CA 1O1
Organization: Google Trust Services
Location: US
Issuer: GlobalSign
Valid from: Jun 15 00:00:42 2017 GMT
Valid until: Dec 15 00:00:42 2021 GMT
Authority: Is a CA
Keysize: 2048 Bits
Organization: Google Trust Services
Location: US
Issuer: GlobalSign
Valid from: Jun 15 00:00:42 2017 GMT
Valid until: Dec 15 00:00:42 2021 GMT
Authority: Is a CA
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. tugasfisikacahayatampakanistasyalaia.blogspot.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Content-Type: text/html; charset=UTF-8
Expires: Mon, 09 Sep 2019 20:50:03 GMT
Date: Mon, 09 Sep 2019 20:50:03 GMT
Cache-Control: private, max-age=0
Last-Modified: Sat, 15 Jun 2019 12:27:21 GMT
ETag: W/"5527b180f3d6dff88b38a0f898a214e7702377d87483ebfffd4d0378ee7e36c7"
Content-Encoding: gzip
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Content-Length: 14001
Server: GSE
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
CNAME | 3600 |