Resrequest.com
ResRequest | Hospitality Software Solutions
Domain Summary
What is the traffic rank for Resrequest.com?
• Resrequest.com ranks #1,090,244 globally on HypeStat.
What percent of global Internet users visit Resrequest.com?
• 6.9E-5% of global Internet users visit Resrequest.com
How many people visit Resrequest.com each day?
• Resrequest.com receives approximately 3.4K visitors and 27,213 page impressions per day.
Which countries does Resrequest.com receive most of its visitors from?
• Resrequest.com is mostly visited by people located in South Africa,Tanzania,Zambia.
How much Resrequest.com can earn?
• Resrequest.com should earn about $46.74/day from advertising revenue.
What is Resrequest.com estimated value?
• Estimated value of Resrequest.com is $47,902.55.
What IP addresses does Resrequest.com resolve to?
• Resrequest.com resolves to the IP addresses 197.189.203.154.
Where are Resrequest.com servers located in?
• Resrequest.com has servers located in South Africa.
resrequest.com Profile
Title:ResRequest | Hospitality Software Solutions
What technologies does resrequest.com use?
These are the technologies used at resrequest.com. resrequest.com has a total of 11 technologies installed in 13 different categories.resrequest.com Traffic Analysis
Resrequest.com is ranked #1,090,244 in the world. This website is viewed by an estimated 3.4K visitors daily, generating a total of 27.2K pageviews. This equates to about 103.1K monthly visitors.Daily Visitors3.4K
Monthly Visits103.1K
Pages per Visit8.00
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 3,402
- Monthly Visits:
- 103,081
- Pages per Visit:
- 8.00
- Daily Pageviews:
- 27,213
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- 6.9E-5%
- HypeRank:
- 1,090,244
Visitors by country
- Country
- Users%
- South Africa 31.9%
- Tanzania 24.1%
- Zambia 7.4%
- Kenya 2.2%
Where do visitors go on resrequest.com?
- Reach%Pageviews%PerUser
- tanganyikawildernesscamps.resrequest.com
- 18.39%10.84%3.5
- idube.resrequest.com
- 14.94%8.92%4
- thesafaricollection.resrequest.com
- 11.88%4.46%2
- asilia.resrequest.com
- 8.81%14.59%10
- shiduli.resrequest.com
- 8.81%5.29%4
Last update was 3010 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with resrequest.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- resrequest.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $46.7 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $1.4K and annual gross revenue of approximately $17.1K. Based on these figures, the site's net worth is estimated at around $47.9K.How much would resrequest.com make?
- Daily Revenue:
- $46.74
- Monthly Revenue:
- $1,402.20
- Yearly Revenue:
- $17,060.10
Daily earning by country
- CountryPageviewsEarning
- South Africa 8,708$6.79
- Tanzania 4,354$4.01
- Zambia 5,443$2.99
- Kenya 272$0.07
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.28
- Monthly Revenue Loss:
- $8.31
- Yearly Revenue Loss:
- $101.16
- Daily Pageviews Blocked:
- 376
- Monthly Pageviews Blocked:
- 11,266
- Yearly Pageviews Blocked:
- 137,072
Daily revenue loss by country
- CountryBlockedLost Money
- South Africa 174$0.14
- Tanzania 87$0.08
- Zambia 109$0.06
- Kenya 5$0.00
How much is resrequest.com worth?
- Website Value:
- $47.9K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- resrequest.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- resrequest.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- resrequest.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is resrequest.com hosted? ▼
Resrequest.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 197.189.203.154
- ASN:
- AS37153
- ISP:
- HETZNER
- Server Location:
South Africa
Other sites hosted on 197.189.203.154
There are no other sites hosted on this IPHow fast does resrequest.com load? ▼
The average loading time of resrequest.com is 1662 ms. The Desktop speed index is 30 and mobile speed index is 99.- Average Load Time:
- 1662 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Does resrequest.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on resrequest.com are reduced by %.
resrequest.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. resrequest.com does not support HTTPS. resrequest.com does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. resrequest.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.HTTP/1.1 200 OK
Date: Tue, 04 Apr 2017 00:18:06 GMT
Server: Apache/2.4.7 (Ubuntu)
X-Powered-By: PHP/5.5.9-1ubuntu4.19
Set-Cookie: PHPSESSID=un8kociv4k76ku590cjt3i3j25; path=/
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://www.resrequest.com/xmlrpc.php
Link: <http://www.resrequest.com/wp-json/>; rel="https://api.w.org/"
Link: <http://www.resrequest.com/>; rel=shortlink
Vary: Accept-Encoding
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
MX | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
MX | 3600 | ||
SOA | 3600 | ||
Mname | ns1.domaindiscover.com | ||
Rname | hostmaster.tierra.net | ||
Serial Number | 2017040318 | ||
Refresh | 7200 | ||
Retry | 1800 | ||
Expire | 604800 | ||
Minimum TTL | 28800 | ||
A | 197.189.203.154 | 3600 | |
TXT | 3600 | ||
TXT | 3600 | ||
NS | 3586 | ||
NS | 3586 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on January 7, 2003 and will expire on July 1, 2025 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on July 1, 2025.- Domain Created:
- 2003-01-07
- Domain Age:
- 22 years 5 months 25 days
- WhoIs:
whois lookup at whois.domaindiscover.com...Domain Name: RESREQUEST.COM Registry Domain ID: Registrar WHOIS Server: whois.domaindiscover.com Registrar URL: https://www.tierra.net Updated Date: 2012-12-11T23:27:38Z Creation Date: 2003-01-07T00:48:10Z Registrar Registration Expiration Date: 2018-01-06T21:48:10Z Registrar: TIERRANET INC. DBA DOMAINDISCOVER Registrar IANA ID: 86 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.6193932105 Reseller: Domain Status: clientTransferProhibited Registry Registrant ID: Registrant Name: Richard Howes Registrant Organization: Workflow Solutions (Pty) Ltd Registrant Street: 50 Union Street Registrant City: Empangeni Registrant State/Province: KwaZulu-Natal Registrant Postal Code: 3880 Registrant Country: ZA Registrant Phone: +27.357725116 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email:
Registry Admin ID: Admin Name: Richard Howes Admin Organization: Workflow Solutions (Pty) Ltd Admin Street: 50 Union Street Admin City: Empangeni Admin State/Province: KwaZulu-Natal Admin Postal Code: 3880 Admin Country: ZA Admin Phone: +27.357725116 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email:
Registry Tech ID: Tech Name: Richard Howes Tech Organization: Workflow Solutions (Pty) Ltd Tech Street: 50 Union Street Tech City: Empangeni Tech State/Province: KwaZulu-Natal Tech Postal Code: 3880 Tech Country: ZA Tech Phone: +27.357725116 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email:
Name Server: NS1.DOMAINDISCOVER.COM Name Server: NS2.DOMAINDISCOVER.COM DNSSEC: URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2017-04-03T17:18:18Z <<< This WHOIS database is provided for information purposes only. We do not guarantee the accuracy of this data. The following uses of this system are expressly prohibited: (1) use of this system for unlawful purposes; (2) use of this system to collect information used in the mass transmission of unsolicited commercial messages in any medium; (3) use of high volume, automated, electronic processes against this database. By submitting this query, you agree to abide by this policy.whois lookup at whois.crsnic.net...Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: RESREQUEST.COM Registrar: TIERRANET INC. D/B/A DOMAINDISCOVER Sponsoring Registrar IANA ID: 86 Whois Server: whois.domaindiscover.com Referral URL: http://www.domaindiscover.com Name Server: NS1.DOMAINDISCOVER.COM Name Server: NS2.DOMAINDISCOVER.COM Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Updated Date: 12-dec-2012 Creation Date: 07-jan-2003 Expiration Date: 07-jan-2018 >>> Last update of whois database: Tue, 04 Apr 2017 00:18:11 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.