resrequest.com Resrequest.com

   
ResRequest | Hospitality Software Solutions

Domain Summary

What is the traffic rank for Resrequest.com?

• Resrequest.com ranks #1,090,244 globally on HypeStat.

What percent of global Internet users visit Resrequest.com?

6.9E-5% of global Internet users visit Resrequest.com

How many people visit Resrequest.com each day?

• Resrequest.com receives approximately 3.4K visitors and 27,213 page impressions per day.

Which countries does Resrequest.com receive most of its visitors from?

• Resrequest.com is mostly visited by people located in South Africa,Tanzania,Zambia.

How much Resrequest.com can earn?

• Resrequest.com should earn about $46.74/day from advertising revenue.

What is Resrequest.com estimated value?

• Estimated value of Resrequest.com is $47,902.55.

What IP addresses does Resrequest.com resolve to?

• Resrequest.com resolves to the IP addresses 197.189.203.154.

Where are Resrequest.com servers located in?

• Resrequest.com has servers located in South Africa.

resrequest.com Profile

Title:ResRequest | Hospitality Software Solutions

What technologies does resrequest.com use?

These are the technologies used at resrequest.com. resrequest.com has a total of 11 technologies installed in 13 different categories.

resrequest.com Traffic Analysis

Resrequest.com is ranked #1,090,244 in the world. This website is viewed by an estimated 3.4K visitors daily, generating a total of 27.2K pageviews. This equates to about 103.1K monthly visitors.
Daily Visitors3.4K
Monthly Visits103.1K
Pages per Visit8.00
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
3,402
Monthly Visits:
103,081
Pages per Visit:
8.00
Daily Pageviews:
27,213
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
6.9E-5%
HypeRank:
1,090,244
*All traffic values are estimates only.

Visitors by country

Country
Users%
 
South Africa 31.9%
 
Tanzania 24.1%
 
Zambia 7.4%
 
Kenya 2.2%

Where do visitors go on resrequest.com?

 
Reach%Pageviews%PerUser
tanganyikawildernesscamps.resrequest.com
18.39%10.84%3.5
idube.resrequest.com
14.94%8.92%4
thesafaricollection.resrequest.com
11.88%4.46%2
asilia.resrequest.com
8.81%14.59%10
shiduli.resrequest.com
8.81%5.29%4
Last update was 3010 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with resrequest.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  resrequest.com
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Revenue report

Google.com would generate approximately $46.7 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $1.4K and annual gross revenue of approximately $17.1K. Based on these figures, the site's net worth is estimated at around $47.9K.

How much would resrequest.com make?

Daily Revenue:
$46.74
Monthly Revenue:
$1,402.20
Yearly Revenue:
$17,060.10
*All earnings values are estimates only.

Daily earning by country

 
CountryPageviewsEarning
 
South Africa 8,708$6.79
 
Tanzania 4,354$4.01
 
Zambia 5,443$2.99
 
Kenya 272$0.07

Loss of money due to Adblock?

Daily Revenue Loss:
$0.28
Monthly Revenue Loss:
$8.31
Yearly Revenue Loss:
$101.16
Daily Pageviews Blocked:
376
Monthly Pageviews Blocked:
11,266
Yearly Pageviews Blocked:
137,072

Daily revenue loss by country

 
CountryBlockedLost Money
 
South Africa 174$0.14
 
Tanzania 87$0.08
 
Zambia 109$0.06
 
Kenya 5$0.00

How much is resrequest.com worth?

Website Value:
$47.9K

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
resrequest.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
resrequest.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
resrequest.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is resrequest.com hosted?

Resrequest.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
197.189.203.154
ASN:
AS37153 
ISP:
HETZNER 
Server Location:

South Africa
 

Other sites hosted on 197.189.203.154

There are no other sites hosted on this IP

How fast does resrequest.com load?

The average loading time of resrequest.com is 1662 ms. The Desktop speed index is 30 and mobile speed index is 99.
Average Load Time:
1662 ms

Page Speed (Google PageSpeed Insights) - Desktop

30
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Lab Data


Page Speed (Google PageSpeed Insights) - Mobile

99
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s)Largest Contentful Paint (LCP) 0%

Lab Data

Does resrequest.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on resrequest.com are reduced by %.
resrequest.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. resrequest.com does not support HTTPS.
 resrequest.com does not support HTTPS
     
Verifying SSL Support. Please wait...

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 resrequest.com does not support HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
HTTP/1.1 200 OK
Date: Tue, 04 Apr 2017 00:18:06 GMT
Server: Apache/2.4.7 (Ubuntu)
X-Powered-By: PHP/5.5.9-1ubuntu4.19
Set-Cookie: PHPSESSID=un8kociv4k76ku590cjt3i3j25; path=/
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://www.resrequest.com/xmlrpc.php
Link: <http://www.resrequest.com/wp-json/>; rel="https://api.w.org/"
Link: <http://www.resrequest.com/>; rel=shortlink
Vary: Accept-Encoding
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
MX aspmx5.googlemail.com 3600
MX aspmx4.googlemail.com 3600
MX aspmx2.googlemail.com 3600
MX aspmx3.googlemail.com 3600
MX alt2.aspmx.l.google.com 3600
MX aspmx.l.google.com 3600
MX alt1.aspmx.l.google.com 3600
SOA 3600
Mname ns1.domaindiscover.com
Rname hostmaster.tierra.net
Serial Number 2017040318
Refresh 7200
Retry 1800
Expire 604800
Minimum TTL 28800
A 197.189.203.154 3600
TXT v=spf1 include:spf.mandrillapp.com include:_spf.elasticemail.com ?all 3600
TXT google-site-verification=mn75ZR5UoMBw2VaP9sEyKI-ghtUrGIaEi_K60SizsDc 3600
NS ns1.domaindiscover.com 3586
NS ns2.domaindiscover.com 3586

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on January 7, 2003 and will expire on July 1, 2025 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on July 1, 2025.
Domain Created:
2003-01-07
Domain Age:
22 years 5 months 25 days
WhoIs:
 

whois lookup at whois.domaindiscover.com...Domain Name: RESREQUEST.COM
Registry Domain ID: 
Registrar WHOIS Server: whois.domaindiscover.com
Registrar URL: https://www.tierra.net
Updated Date: 2012-12-11T23:27:38Z
Creation Date: 2003-01-07T00:48:10Z
Registrar Registration Expiration Date: 2018-01-06T21:48:10Z
Registrar: TIERRANET INC. DBA DOMAINDISCOVER
Registrar IANA ID: 86
Registrar Abuse Contact Email: email
Registrar Abuse Contact Phone: +1.6193932105
Reseller: 
Domain Status: clientTransferProhibited
Registry Registrant ID:
Registrant Name: Richard Howes
Registrant Organization: Workflow Solutions (Pty) Ltd
Registrant Street: 50 Union Street
Registrant City: Empangeni
Registrant State/Province: KwaZulu-Natal
Registrant Postal Code: 3880
Registrant Country: ZA
Registrant Phone: +27.357725116
Registrant Phone Ext:
Registrant Fax: 
Registrant Fax Ext:
Registrant Email: email
Registry Admin ID:
Admin Name: Richard Howes
Admin Organization: Workflow Solutions (Pty) Ltd
Admin Street: 50 Union Street
Admin City: Empangeni
Admin State/Province: KwaZulu-Natal
Admin Postal Code: 3880
Admin Country: ZA
Admin Phone: +27.357725116
Admin Phone Ext:
Admin Fax: 
Admin Fax Ext:
Admin Email: email
Registry Tech ID:
Tech Name: Richard Howes
Tech Organization: Workflow Solutions (Pty) Ltd
Tech Street: 50 Union Street
Tech City: Empangeni
Tech State/Province: KwaZulu-Natal
Tech Postal Code: 3880
Tech Country: ZA
Tech Phone: +27.357725116
Tech Phone Ext:
Tech Fax: 
Tech Fax Ext:
Tech Email: email
Name Server: NS1.DOMAINDISCOVER.COM
Name Server: NS2.DOMAINDISCOVER.COM
DNSSEC: 
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2017-04-03T17:18:18Z <<<

This WHOIS database is provided for information purposes only. We do
not guarantee the accuracy of this data. The following uses of this 
system are expressly prohibited: (1) use of this system for unlawful 
purposes; (2) use of this system to collect information used in the 
mass transmission of unsolicited commercial messages in any medium; 
(3) use of high volume, automated, electronic processes against this 
database. By submitting this query, you agree to abide by this 
policy.whois lookup at whois.crsnic.net...Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

   Domain Name: RESREQUEST.COM
   Registrar: TIERRANET INC. D/B/A DOMAINDISCOVER
   Sponsoring Registrar IANA ID: 86
   Whois Server: whois.domaindiscover.com
   Referral URL: http://www.domaindiscover.com
   Name Server: NS1.DOMAINDISCOVER.COM
   Name Server: NS2.DOMAINDISCOVER.COM
   Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Updated Date: 12-dec-2012
   Creation Date: 07-jan-2003
   Expiration Date: 07-jan-2018

>>> Last update of whois database: Tue, 04 Apr 2017 00:18:11 GMT <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar.  Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability.  VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.