Ravenhawksmagickalmysticalplaces.net
Ravenhawks' Magickal Mystical Places – Information and Products for Magick and Mysticism Practices
Domain Summary
What is the traffic rank for Ravenhawksmagickalmysticalplaces.net?
• Ravenhawksmagickalmysticalplaces.net ranks #10,668,154 globally on HypeStat.
What IP addresses does Ravenhawksmagickalmysticalplaces.net resolve to?
• Ravenhawksmagickalmysticalplaces.net resolves to the IP addresses 192.0.78.24.
Where are Ravenhawksmagickalmysticalplaces.net servers located in?
• Ravenhawksmagickalmysticalplaces.net has servers located in San Francisco, California, 94110, United States.
ravenhawksmagickalmysticalplaces.net Profile
Title:Ravenhawks' Magickal Mystical Places – Information and Products for Magick and Mysticism Practices
Description:Information and Products for Magick and Mysticism Practices
What technologies does ravenhawksmagickalmysticalplaces.net use?
These are the technologies used at ravenhawksmagickalmysticalplaces.net. ravenhawksmagickalmysticalplaces.net has a total of 6 technologies installed in 8 different categories.ravenhawksmagickalmysticalplaces.net Traffic Analysis
Ravenhawksmagickalmysticalplaces.net is ranked #10,668,154 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 10,668,154
Last update was 2350 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with ravenhawksmagickalmysticalplaces.net in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- ravenhawksmagickalmysticalplaces.net
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- ravenhawksmagickalmysticalplaces.net
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- ravenhawksmagickalmysticalplaces.net
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- ravenhawksmagickalmysticalplaces.net
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is ravenhawksmagickalmysticalplaces.net hosted? ▼
Ravenhawksmagickalmysticalplaces.net may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 192.0.78.24
- ASN:
- AS2635
- ISP:
- Automattic, Inc
- Server Location:
- San Francisco
California, CA
94110
United States, US
Other sites hosted on 192.0.78.24
Does ravenhawksmagickalmysticalplaces.net use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on ravenhawksmagickalmysticalplaces.net are reduced by 75%.
ravenhawksmagickalmysticalplaces.net use gzip compression.
Original size: 68.93 KB
Compressed size: 16.62 KB
File reduced by: 52.31 KB (75%)
Compressed size: 16.62 KB
File reduced by: 52.31 KB (75%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. ravenhawksmagickalmysticalplaces.net supports HTTPS. ravenhawksmagickalmysticalplaces.net supports HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. ravenhawksmagickalmysticalplaces.net supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Server: nginx
Date: Tue, 21 May 2019 05:41:03 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/7.0.33
Location: https://hsi-hostings.com/
X-Powered-By: PleskLin
HTTP/1.1 200 OK
Server: nginx
Date: Tue, 21 May 2019 05:41:04 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/7.0.33
Link: <https://hsi-hostings.com/wp-json/>; rel="https://api.w.org/", <https://hsi-hostings.com/>; rel=shortlink
X-Powered-By: PleskLin
Date: Tue, 21 May 2019 05:41:06 GMT
Server: Apache
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=iso-8859-1
Server: nginx
Date: Tue, 21 May 2019 05:41:08 GMT
Content-Type: text/html; charset=iso-8859-1
Content-Length: 209
Connection: keep-alive
Location: https://nekolife0809.com/
Cache-Control: max-age=1
Expires: Tue, 21 May 2019 05:41:09 GMT
HTTP/2 200
server: nginx
date: Tue, 21 May 2019 05:41:11 GMT
content-type: text/html; charset=UTF-8
vary: Accept-Encoding
link: <https://nekolife0809.com/wp-json/>; rel="https://api.w.org/"
vary: Accept-Encoding
cache-control: max-age=1
expires: Tue, 21 May 2019 05:41:10 GMT
content-encoding: gzip
Server: nginx
Date: Tue, 21 May 2019 05:41:13 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Location: https://perfect-health-online.com/
HTTP/1.1 200 OK
Server: nginx
Date: Tue, 21 May 2019 05:41:13 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Vary: Accept-Encoding
X-Powered-By: PHP/7.2.18
Set-Cookie: PHPSESSID=77ed5ca9309526035d744a67f85bdd16; path=/; HttpOnly
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Strict-Transport-Security: max-age=15768000
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Content-Encoding: gzip
date: Tue, 21 May 2019 05:41:16 GMT
x-servedby: v6-site-79cbfb8bd7-r59gz
location: https://www.geektherapytraining.com/
server: envoy
Age: 0
X-Varnish: varnish-web012
Set-Cookie: crumb=BZPZFnyzDOG9ODdmZTQzNzBmYWQwYmJhYWJkOTViNTYzNzVkNWFl;Path=/
Transfer-Encoding: chunked
x-contextid: 0ApxwIO4/aKJCc6cS
x-via: 1.1 echo024
HTTP/2 200
date: Tue, 21 May 2019 05:41:16 GMT
x-servedby: v6-site-79cbfb8bd7-qtsdh
strict-transport-security: max-age=0
expires: Thu, 01 Jan 1970 00:00:00 GMT
content-type: text/html; charset=UTF-8
x-pc-appver: 18037
x-pc-date: Thu, 16 May 2019 14:21:52 GMT
x-pc-host: 10.122.8.17
last-modified: Mon, 20 May 2019 23:49:39 GMT
content-encoding: gzip
etag: W/"c92504362b3926a92fd4340e727e2213"
x-pc-key: yu9-EGJK26ucyZCKIGRHqad4bG8-pike-sealion-7ljx
x-pc-hit: true
content-length: 15876
server: envoy
vary: Accept-Encoding
age: 0
x-varnish: varnish-web008
set-cookie: crumb=BU9dttKhpYjRMmIxMzgyNTcxMGIyYzY0ZWVmN2ZlMzM3YjBmOTk5;Path=/
accept-ranges: bytes
x-contextid: xteTD3eE/A0ugr8wB
x-via: 1.1 echo025
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /XZeVp/
HTTP/1.1 302 Found
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /
HTTP/1.1 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Tue, 21 May 2019 05:41:17 GMT
Content-Length: 6197
Age: 1
Connection: keep-alive
Cache-Control: no-cache, no-store, private, must-revalidate, max-age=0, max-stale=0, post-check=0, pre-check=0
Location: https://heididoesdesign.com/
Server: api-gateway/1.9.3.1
X-App-Name: Pro2-View
X-Content-Type-Options: nosniff
X-Locale: en_us
X-Trace-Id: uoEihAvN4wl2QUgpPrzhYjUwApg
X-XSS-Protection: 1; mode=block
Accept-Ranges: bytes
Age: 0
Content-Length: 0
Accept-Ranges: bytes
Date: Tue, 21 May 2019 05:41:19 GMT
Via: 1.1 varnish
Age: 0
Connection: keep-alive
X-Served-By: cache-mdw17378-MDW
X-Cache: MISS
X-Cache-Hits: 0
X-Timer: S1558417279.024393,VS0,VE74
Vary: Accept-Language, Accept-Encoding,Fastly-SSL
HTTP/1.1 200 OK
Cache-Control: s-maxage=2592000
Content-Encoding: gzip
Content-Type: text/html; charset=utf-8
Server: api-gateway/1.9.3.1
Strict-Transport-Security: max-age=7776000
X-App-Name: Pro2-View
X-Content-Type-Options: nosniff
X-Locale: en_us
X-Trace-Id: 2DXJ7wS4mH6K57S9KB8ltxLlEkw
X-XSS-Protection: 1; mode=block
Content-Length: 27667
Accept-Ranges: bytes
Date: Tue, 21 May 2019 05:41:19 GMT
Via: 1.1 varnish
Age: 17758
Connection: keep-alive
X-Served-By: cache-mdw17325-MDW
X-Cache: HIT
X-Cache-Hits: 1
X-Timer: S1558417279.126040,VS0,VE1
Vary: Accept-Encoding, Accept-Language, Accept-Encoding,Fastly-SSL
Date: Tue, 21 May 2019 05:41:20 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=dcca67af006dd595ab4f3cb0b4e59507c1558417280; expires=Wed, 20-May-20 05:41:20 GMT; path=/; domain=.do-debtconsolidation-ok.live; HttpOnly
Referrer-Policy: origin-when-cross-origin
Server: cloudflare
CF-RAY: 4da438802a5cc61f-MSP
Content-Encoding: gzip
Date: Tue, 21 May 2019 05:41:22 GMT
Connection: keep-alive
X-Wix-Server-Artifact-Id: wix-public-war
Expires: -1
X-Wix-Redirect-Reason: ProtocolSwitchingRedirector
X-Wix-Redirected-From: http://www.ladywithermine.com/
Location: https://www.ladywithermine.com/
X-Seen-By: BTzakfJUbU/4CBguyutVd2yM24MUp/cs5sqTkd+4hpI=,1wy2ILu/S4rlWT/R4rqCrevOYhH21aOeLZKA+Zso+0g=,LwsIp90Tma5sliyMxJYVEsDlh1h4AMQX7u4R8qzCokk=
Cache-Control: no-cache
Pragma: no-cache
Content-Language: en
X-Wix-Request-Id: 1558417282.0036821532869180786
Set-Cookie: TS01e85bed=01f0e931310fa03b38a54ff9335b8307bed22a5a226f5458b2e8f12fc6f0d6803740515bd189ee0f7c99bc55cb66232f36a7ef7e3a; Path=/
Transfer-Encoding: chunked
HTTP/1.1 200 OK
Date: Tue, 21 May 2019 05:41:22 GMT
Content-Type: text/html;charset=utf-8
Connection: keep-alive
X-Wix-Server-Artifact-Id: wix-public-war
Set-Cookie: hs=-378290771;Path=/;Domain=www.ladywithermine.com;HttpOnly
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Set-Cookie: svSession=9f8096d13702b734e3050534b5a2363fa3265d4b7bdf6a701e1259094d04fcd627e152149c0a61a80c786ebe6c1de75c1e60994d53964e647acf431e4f798bcd0dd8262fb940783759303372d12e1843145a870dd01e670614ce970286b7fd0a;Path=/;Domain=www.ladywithermine.com;Expires=Fri, 21-May-2021 05:41:21 GMT
Set-Cookie: XSRF-TOKEN=1558417282|4fKZfgRzWErX;Path=/;Domain=www.ladywithermine.com
X-Wix-Request-Id: 1558417282.49750197153251100505
Expires: -1
X-Seen-By: BTzakfJUbU/4CBguyutVdyMESTMpd5BvehYZuft2BJg=,1wy2ILu/S4rlWT/R4rqCrV6532kpl/zczQeCvAaiS2o=,LwsIp90Tma5sliyMxJYVEoJZsDFVZ6gMLChkfHCPtDg=,I2ZOrNA1LIowGTY6Ll7mx2kMSM9osWg3vCAMLjy3iII=,1wy2ILu/S4rlWT/R4rqCrcK6tS8RpEOF1vpReGSuBAc=,Tw2AanFDQ+Wwo8Xxk6ZL7rHKeAJXtkPxqn+uc4aMlODxRLDtqfZ4yULfZB9JrZDq
Cache-Control: no-cache
Pragma: no-cache
Content-Language: en
Vary: User-Agent
Content-Encoding: gzip
Set-Cookie: TS01e85bed=01b84e286a9d5e737941f9c7fb34bbaf1da971afddd7983924b92ce073d5043d7fe2590ea554ced7bfd89956f45458ce1cb44208f4; Path=/
Set-Cookie: TS01360595=01b84e286a91b0473794bae42d29b2cac46cfe16fbd7983924b92ce073d5043d7fe2590ea54e8e70851b7a48d2884e8c8ac1b9b6b367d7dadd1a5279f6f137377403f13f64a044b3de1b98516da650ffa0e423538bb9ab9de9cfe524bd82df9db7398f62b3; path=/; domain=www.ladywithermine.com
Transfer-Encoding: chunked
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /cSUZQ/
HTTP/1.1 302 Found
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /
HTTP/1.1 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Tue, 21 May 2019 05:41:23 GMT
Content-Length: 462
Age: 1
Connection: keep-alive
Server: nginx
Date: Tue, 21 May 2019 05:41:25 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://ravenhawksmagickalmysticalplaces.net/
X-ac: 3.ord _dca
HTTP/2 200
server: nginx
date: Tue, 21 May 2019 05:41:28 GMT
content-type: text/html; charset=UTF-8
strict-transport-security: max-age=86400
vary: Accept-Encoding
vary: Cookie
x-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
link: <https://wp.me/a5THe>; rel=shortlink
content-encoding: gzip
x-ac: 3.ord _dca
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| SOA | 3600 | ||
| Mname | ns1.wordpress.com | ||
| Rname | hostmaster.wordpress.com | ||
| Serial Number | 2005071858 | ||
| Refresh | 14400 | ||
| Retry | 7200 | ||
| Expire | 604800 | ||
| Minimum TTL | 300 | ||
| A | 192.0.78.25 | 300 | |
| A | 192.0.78.24 | 300 | |
| NS | 3599 | ||
| NS | 3599 | ||
| NS | 3599 |