franklinpharmacyandhealthcare.com Franklinpharmacyandhealthcare.com

   
Home | Franklin *** Inc (330) 369-4567 | Warren, OH

Domain Summary

What is the traffic rank for Franklinpharmacyandhealthcare.com?

• Franklinpharmacyandhealthcare.com ranks #7,299,960 globally on HypeStat.

What IP addresses does Franklinpharmacyandhealthcare.com resolve to?

• Franklinpharmacyandhealthcare.com resolves to the IP addresses 146.88.98.18.

Where are Franklinpharmacyandhealthcare.com servers located in?

• Franklinpharmacyandhealthcare.com has servers located in Richardson, TX, 75082, United States.

franklinpharmacyandhealthcare.com Profile

Title:Home | Franklin *** Inc (330) 369-4567 | Warren, OH

What technologies does franklinpharmacyandhealthcare.com use?

These are the technologies used at franklinpharmacyandhealthcare.com. franklinpharmacyandhealthcare.com has a total of 12 technologies installed in 7 different categories.

franklinpharmacyandhealthcare.com Traffic Analysis

Franklinpharmacyandhealthcare.com is ranked #7,299,960 in the world.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
7,299,960
SEMrush Rank:
935,786
*All traffic values are estimates only.
Last update was 1723 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with franklinpharmacyandhealthcare.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  franklinpharmacyandhealthcare.com
Rank:
(Rank based on keywords, cost and organic traffic)
  935,786
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  340
Organic Traffic:
(Number of visitors coming from top 20 search results)
  589
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $2,156.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
franklinpharmacyandhealthcare.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
franklinpharmacyandhealthcare.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
franklinpharmacyandhealthcare.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is franklinpharmacyandhealthcare.com hosted?

Franklinpharmacyandhealthcare.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
146.88.98.18
ASN:
AS35914 
ISP:
Armor Defense Inc 
Server Location:
Richardson
TX
75082
United States
 

Other sites hosted on 146.88.98.18

How fast does franklinpharmacyandhealthcare.com load?

The average loading time of franklinpharmacyandhealthcare.com is n/a ms. The Desktop speed index is 48 and mobile speed index is 100.
Average Load Time:
n/a ms

Page Speed (Google PageSpeed Insights) - Desktop

48
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Lab Data


Page Speed (Google PageSpeed Insights) - Mobile

100
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s)Largest Contentful Paint (LCP) 0%

Lab Data

Does franklinpharmacyandhealthcare.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on franklinpharmacyandhealthcare.com are reduced by %.
franklinpharmacyandhealthcare.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. franklinpharmacyandhealthcare.com supports HTTPS.
 franklinpharmacyandhealthcare.com supports HTTPS
     
Verifying SSL Support. Please wait...
Common Name: www.franklinpharmacyandhealthcare.com
Organization:
Location:
Issuer: RapidSSL SHA256 CA
Valid from: Oct 31 00:00:00 2017 GMT
Valid until: Nov 30 23:59:59 2018 GMT
Authority:
Keysize:

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 franklinpharmacyandhealthcare.com does not support HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
HTTP/1.1 301 Moved Permanently
Date: Wed, 29 Nov 2017 21:59:32 GMT
Server: Apache
Location: https://www.franklinpharmacyandhealthcare.com/
Cache-Control: max-age=604800
Expires: Wed, 06 Dec 2017 21:59:32 GMT
Vary: Accept-Encoding
Content-Length: 254
Connection: close
Content-Type: text/html; charset=iso-8859-1
HTTP/1.1 200 OK
Date: Wed, 29 Nov 2017 21:59:32 GMT
Server: Apache
Set-Cookie: PHPSESSID=71c797c1345bc902d5bb0b9216c1136e; path=/; secure; HttpOnly
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Connection: close
Content-Type: text/html

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
MX mx1.emailsrvr.com 1800
SOA 3600
Mname dns1.name-services.com
Rname info.name-services.com
Serial Number 1446773045
Refresh 172800
Retry 900
Expire 1814400
Minimum TTL 3600
A 146.88.98.18 1788
NS dns2.name-services.com 3587
NS dns5.name-services.com 3587
NS dns3.name-services.com 3587
NS dns4.name-services.com 3587
NS dns1.name-services.com 3587

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on August 15, 2003 and will expire on March 26, 2025 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on March 26, 2025.
Domain Created:
2003-08-15
Domain Age:
21 years 7 months 11 days
WhoIs:
 

whois lookup at whois.enom.com...Domain Name: FRANKLINPHARMACYANDHEALTHCARE.COM
Registry Domain ID: 102119557_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2017-07-17T01:18:07.00Z
Creation Date: 2003-08-15T17:33:00.00Z
Registrar Registration Expiration Date: 2018-08-15T17:33:00.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: 
Registrant Name: FRANKLIN MANIOS
Registrant Organization: FRANKLIN *** INC
Registrant Street: 1732 YOUNGSTOWN RD SE
Registrant City: WARREN
Registrant State/Province: OH
Registrant Postal Code: 44484
Registrant Country: US
Registrant Phone: +1.3303694567
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext:
Registrant Email: email
Registry Admin ID: 
Admin Name: FRANKLIN MANIOS
Admin Organization: FRANKLIN *** INC
Admin Street: 1732 YOUNGSTOWN RD SE
Admin City: WARREN
Admin State/Province: OH
Admin Postal Code: 44484
Admin Country: US
Admin Phone: +1.3303694567
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext:
Admin Email: email
Registry Tech ID: 
Tech Name: WEB TEAM
Tech Organization: REFILLRX CONNECT
Tech Street: P.O. BOX 622992
Tech City: OVIEDO
Tech State/Province: FL
Tech Postal Code: 32762-2992
Tech Country: US
Tech Phone: +1.8884075440
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: email
Name Server: DNS1.NAME-SERVICES.COM
Name Server: DNS2.NAME-SERVICES.COM
Name Server: DNS3.NAME-SERVICES.COM
Name Server: DNS4.NAME-SERVICES.COM
Name Server: DNS5.NAME-SERVICES.COM
DNSSEC: unSigned
Registrar Abuse Contact Email: email
Registrar Abuse Contact Phone: +1.4252982646
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2017-07-17T01:18:07.00Z <<<

For more information on Whois status codes, please visit https://icann.org/epp


The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available "as is," and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.  

We reserve the right to modify these terms at any time. By submitting 
this query, you agree to abide by these terms.
Version 6.3 4/3/2002

Get Noticed on the Internet!  Increase visibility for this domain name by listing it at www.whoisbusinesslistings.comwhois lookup at whois.crsnic.net...Domain Name: FRANKLINPHARMACYANDHEALTHCARE.COM
   Registry Domain ID: 102119557_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.enom.com
   Registrar URL: http://www.enom.com
   Updated Date: 2017-07-17T08:18:06Z
   Creation Date: 2003-08-15T17:33:18Z
   Registry Expiry Date: 2018-08-15T17:33:18Z
   Registrar: eNom, Inc.
   Registrar IANA ID: 48
   Registrar Abuse Contact Email:
   Registrar Abuse Contact Phone:
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: DNS1.NAME-SERVICES.COM
   Name Server: DNS2.NAME-SERVICES.COM
   Name Server: DNS3.NAME-SERVICES.COM
   Name Server: DNS4.NAME-SERVICES.COM
   Name Server: DNS5.NAME-SERVICES.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-11-29T21:59:54Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar.  Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability.  VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.