Franklinpharmacyandhealthcare.com
Home | Franklin *** Inc (330) 369-4567 | Warren, OHDomain Summary
What is the traffic rank for Franklinpharmacyandhealthcare.com?
• Franklinpharmacyandhealthcare.com ranks #15,399,998 globally on HypeStat.
What IP addresses does Franklinpharmacyandhealthcare.com resolve to?
• Franklinpharmacyandhealthcare.com resolves to the IP addresses 146.88.98.18.
Where are Franklinpharmacyandhealthcare.com servers located in?
• Franklinpharmacyandhealthcare.com has servers located in Richardson, TX, 75082, United States.
franklinpharmacyandhealthcare.com Profile
Title:Home | Franklin *** Inc (330) 369-4567 | Warren, OH
What technologies does franklinpharmacyandhealthcare.com use?
These are the technologies used at franklinpharmacyandhealthcare.com. franklinpharmacyandhealthcare.com has a total of 12 technologies installed in 7 different categories.franklinpharmacyandhealthcare.com Traffic Analysis
Franklinpharmacyandhealthcare.com is ranked #15,399,998 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 15,399,998
- SEMrush Rank:
- 935,786
Backlinks Report ▼
Franklinpharmacyandhealthcare.com has a total of 12 backlinks from 6 referring domains.- Total Backlinks:
- 12
- Follow Links:
- 4
- Nofollow Links:
- 8
- Referring Domains:
- 6
- Referring IPs:
- 8
- Authority Domain Score:
- 1
Last update was 1438 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with franklinpharmacyandhealthcare.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- franklinpharmacyandhealthcare.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 935,786
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 340
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 589
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $2,156.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- franklinpharmacyandhealthcare.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- franklinpharmacyandhealthcare.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- franklinpharmacyandhealthcare.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is franklinpharmacyandhealthcare.com hosted? ▼
Franklinpharmacyandhealthcare.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 146.88.98.18
- ASN:
- AS35914
- ISP:
- Armor Defense Inc
- Server Location:
- Richardson
TX
75082
United States
Other sites hosted on 146.88.98.18
How fast does franklinpharmacyandhealthcare.com load? ▼
The average loading time of franklinpharmacyandhealthcare.com is n/a ms. The Desktop speed index is 48 and mobile speed index is 100.- Average Load Time:
- n/a ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Lab Data
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Lab Data
Does franklinpharmacyandhealthcare.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on franklinpharmacyandhealthcare.com are reduced by %.
franklinpharmacyandhealthcare.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. franklinpharmacyandhealthcare.com supports HTTPS. franklinpharmacyandhealthcare.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.franklinpharmacyandhealthcare.com
Organization:
Location:
Issuer: RapidSSL SHA256 CA
Valid from: Oct 31 00:00:00 2017 GMT
Valid until: Nov 30 23:59:59 2018 GMT
Authority:
Keysize:
Organization:
Location:
Issuer: RapidSSL SHA256 CA
Valid from: Oct 31 00:00:00 2017 GMT
Valid until: Nov 30 23:59:59 2018 GMT
Authority:
Keysize:
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. franklinpharmacyandhealthcare.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.HTTP/1.1 301 Moved Permanently
Date: Wed, 29 Nov 2017 21:59:32 GMT
Server: Apache
Location: https://www.franklinpharmacyandhealthcare.com/
Cache-Control: max-age=604800
Expires: Wed, 06 Dec 2017 21:59:32 GMT
Vary: Accept-Encoding
Content-Length: 254
Connection: close
Content-Type: text/html; charset=iso-8859-1
HTTP/1.1 200 OK
Date: Wed, 29 Nov 2017 21:59:32 GMT
Server: Apache
Set-Cookie: PHPSESSID=71c797c1345bc902d5bb0b9216c1136e; path=/; secure; HttpOnly
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Connection: close
Content-Type: text/html
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
MX | 1800 | ||
SOA | 3600 | ||
Mname | dns1.name-services.com | ||
Rname | info.name-services.com | ||
Serial Number | 1446773045 | ||
Refresh | 172800 | ||
Retry | 900 | ||
Expire | 1814400 | ||
Minimum TTL | 3600 | ||
A | 146.88.98.18 | 1788 | |
NS | 3587 | ||
NS | 3587 | ||
NS | 3587 | ||
NS | 3587 | ||
NS | 3587 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on August 15, 2003 and will expire on June 13, 2024 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on June 13, 2024.- Domain Created:
- 2003-08-15
- Domain Age:
- 20 years 9 months 29 days
- WhoIs:
whois lookup at whois.enom.com...Domain Name: FRANKLINPHARMACYANDHEALTHCARE.COM Registry Domain ID: 102119557_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.enom.com Registrar URL: www.enom.com Updated Date: 2017-07-17T01:18:07.00Z Creation Date: 2003-08-15T17:33:00.00Z Registrar Registration Expiration Date: 2018-08-15T17:33:00.00Z Registrar: ENOM, INC. Registrar IANA ID: 48 Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: FRANKLIN MANIOS Registrant Organization: FRANKLIN *** INC Registrant Street: 1732 YOUNGSTOWN RD SE Registrant City: WARREN Registrant State/Province: OH Registrant Postal Code: 44484 Registrant Country: US Registrant Phone: +1.3303694567 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Registry Admin ID: Admin Name: FRANKLIN MANIOS Admin Organization: FRANKLIN *** INC Admin Street: 1732 YOUNGSTOWN RD SE Admin City: WARREN Admin State/Province: OH Admin Postal Code: 44484 Admin Country: US Admin Phone: +1.3303694567 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Registry Tech ID: Tech Name: WEB TEAM Tech Organization: REFILLRX CONNECT Tech Street: P.O. BOX 622992 Tech City: OVIEDO Tech State/Province: FL Tech Postal Code: 32762-2992 Tech Country: US Tech Phone: +1.8884075440 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Name Server: DNS1.NAME-SERVICES.COM Name Server: DNS2.NAME-SERVICES.COM Name Server: DNS3.NAME-SERVICES.COM Name Server: DNS4.NAME-SERVICES.COM Name Server: DNS5.NAME-SERVICES.COM DNSSEC: unSigned Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.4252982646 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2017-07-17T01:18:07.00Z <<< For more information on Whois status codes, please visit https://icann.org/epp The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is," and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms. Version 6.3 4/3/2002 Get Noticed on the Internet! Increase visibility for this domain name by listing it at www.whoisbusinesslistings.comwhois lookup at whois.crsnic.net...Domain Name: FRANKLINPHARMACYANDHEALTHCARE.COM Registry Domain ID: 102119557_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.enom.com Registrar URL: http://www.enom.com Updated Date: 2017-07-17T08:18:06Z Creation Date: 2003-08-15T17:33:18Z Registry Expiry Date: 2018-08-15T17:33:18Z Registrar: eNom, Inc. Registrar IANA ID: 48 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: DNS1.NAME-SERVICES.COM Name Server: DNS2.NAME-SERVICES.COM Name Server: DNS3.NAME-SERVICES.COM Name Server: DNS4.NAME-SERVICES.COM Name Server: DNS5.NAME-SERVICES.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2017-11-29T21:59:54Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.