evdenevenakliyatfirmalari.site Evdenevenakliyatfirmalari.site

   

Domain Summary

What is the traffic rank for Evdenevenakliyatfirmalari.site?

• Evdenevenakliyatfirmalari.site ranks #16,167,627 globally on HypeStat.

What IP addresses does Evdenevenakliyatfirmalari.site resolve to?

• Evdenevenakliyatfirmalari.site resolves to the IP addresses 176.53.74.78.

Where are Evdenevenakliyatfirmalari.site servers located in?

• Evdenevenakliyatfirmalari.site has servers located in Turkey.

evdenevenakliyatfirmalari.site Profile

What technologies does evdenevenakliyatfirmalari.site use?

These are the technologies used at evdenevenakliyatfirmalari.site. evdenevenakliyatfirmalari.site has a total of 10 technologies installed in 12 different categories.

evdenevenakliyatfirmalari.site Traffic Analysis

Evdenevenakliyatfirmalari.site is ranked #16,167,627 in the world.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
16,167,627
*All traffic values are estimates only.
Last update was 1203 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with evdenevenakliyatfirmalari.site in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  evdenevenakliyatfirmalari.site
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
evdenevenakliyatfirmalari.site
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
evdenevenakliyatfirmalari.site
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
evdenevenakliyatfirmalari.site
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is evdenevenakliyatfirmalari.site hosted?

Evdenevenakliyatfirmalari.site may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
176.53.74.78
ASN:
AS42926 
ISP:
Radore Veri Merkezi Hizmetleri A.S. 
Server Location:

Turkey, TR
 

Other sites hosted on 176.53.74.78

Does evdenevenakliyatfirmalari.site use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on evdenevenakliyatfirmalari.site are reduced by 85%.
evdenevenakliyatfirmalari.site use gzip compression.
Original size: 107.58 KB
Compressed size: 15.95 KB
File reduced by: 91.63 KB (85%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. evdenevenakliyatfirmalari.site does not support HTTPS.
 evdenevenakliyatfirmalari.site does not support HTTPS
     
Verifying SSL Support. Please wait...

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 evdenevenakliyatfirmalari.site does not support HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
SOA 3600
Mname ns1.wnokta.com
Rname hostmaster.evdenevenakliyatfirmalari.site
Serial Number 2020050306
Refresh 14400
Retry 3600
Expire 1209600
Minimum TTL 86400
TXT v=spf1 a mx ip4:176.53.74.93 ~all 3600
MX mail.evdenevenakliyatfirmalari.site 3600
A 176.53.74.78 3557
NS ns1.wnokta.com 3556
NS ns2.wnokta.com 3556

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on April 1, 2020 and will expire on May 6, 2024 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on May 6, 2024.
Domain Created:
2020-04-01
Domain Age:
4 years 1 months 5 days
WhoIs:
 

whois lookup at whois.centralnic.com...Domain Name: EVDENEVENAKLIYATFIRMALARI.SITE
Registry Domain ID: D180991304-CNIC
Registrar WHOIS Server: whois.isimtescil.net
Registrar URL: http://www.isimtescil.net
Updated Date: 2020-05-03T10:03:22.0Z
Creation Date: 2020-04-01T12:16:18.0Z
Registry Expiry Date: 2021-04-01T23:59:59.0Z
Registrar: FBS Inc.
Registrar IANA ID: 1110
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: FBS INC / Whoisprotection.biz
Registrant State/Province: Istanbul
Registrant Country: TR
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: NS1.WNOKTA.COM
DNSSEC: unsigned
Billing Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registrar Abuse Contact Email: email
Registrar Abuse Contact Phone: +90.8502000444
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-01-19T08:54:45.0Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

>>> IMPORTANT INFORMATION ABOUT THE DEPLOYMENT OF RDAP: please visit
https://www.centralnic.com/support/rdap <<<

The Whois and RDAP services are provided by CentralNic, and contain
information pertaining to Internet domain names registered by our
our customers. By using this service you are agreeing (1) not to use any
information presented here for any purpose other than determining
ownership of domain names, (2) not to store or reproduce this data in
any way, (3) not to use any high-volume, automated, electronic processes
to obtain data from this service. Abuse of this service is monitored and
actions in contravention of these terms will result in being permanently
blacklisted. All data is (c) CentralNic Ltd (https://www.centralnic.com)

Access to the Whois and RDAP services is rate limited. For more
information, visit https://registrar-console.centralnic.com/pub/whois_guidance.