criminaldefenselawyermarketing.com Criminaldefenselawyermarketing.com

   
Law Firm Marketing Experts - Digital Marketing Agency for Lawyers

Domain Summary

What IP addresses does Criminaldefenselawyermarketing.com resolve to?

• Criminaldefenselawyermarketing.com resolves to the IP addresses 15.197.225.128.

Where are Criminaldefenselawyermarketing.com servers located in?

• Criminaldefenselawyermarketing.com has servers located in United States.

criminaldefenselawyermarketing.com Profile

Title:Law Firm Marketing Experts - Digital Marketing Agency for Lawyers Description:Experienced, reliable law firm marketing agency specializing in digital marketing and web design for solo lawyers and law firms.

What technologies does criminaldefenselawyermarketing.com use?

These are the technologies used at criminaldefenselawyermarketing.com. criminaldefenselawyermarketing.com has a total of 13 technologies installed in 15 different categories.

criminaldefenselawyermarketing.com Traffic Analysis

There's no enough data about criminaldefenselawyermarketing.com traffic.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
n/a
*All traffic values are estimates only.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  criminaldefenselawyermarketing.com
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00
Last update was 45 mins ago
     
This can take up to 60 seconds. Please wait...

Update will be available in 24 hours
*HypeStat.com is not promoting or affiliated with criminaldefenselawyermarketing.com in any way. Only publicly available statistics data are displayed.

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
criminaldefenselawyermarketing.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
criminaldefenselawyermarketing.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
criminaldefenselawyermarketing.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is criminaldefenselawyermarketing.com hosted?

Criminaldefenselawyermarketing.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
15.197.225.128
ASN:
AS16509 
ISP:
Amazon.com, Inc. 
Server Location:

United States, US
 

Other sites hosted on 15.197.225.128

How fast does criminaldefenselawyermarketing.com load?

The average loading time of criminaldefenselawyermarketing.com is 821 ms. The Desktop speed index is 0 and mobile speed index is 85.
Average Load Time:
821 ms

Page Speed (Google PageSpeed Insights) - Mobile

85
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s)Largest Contentful Paint (LCP) 0%

Lab Data

Largest Contentful Paint 3.4 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Time to Interactive 3.4 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
INP breakdown  
Start investigating by looking at the longest subpart. how to improve INP
Max Potential First Input Delay 20 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
First Contentful Paint 3.4 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Speed Index 3.4 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Total Blocking Time 0 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric

Does criminaldefenselawyermarketing.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on criminaldefenselawyermarketing.com are reduced by 76%.
criminaldefenselawyermarketing.com use gzip compression.
Original size: 97.76 KB
Compressed size: 22.98 KB
File reduced by: 74.78 KB (76%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

MyWot.com Reputation Ratings

MyWOT (short for "My Web of Trust") is a web-based reputation and rating service that provides users with information about the trustworthiness and safety of websites.
Status:
  NOT_SAFE

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. criminaldefenselawyermarketing.com supports HTTPS.
 criminaldefenselawyermarketing.com supports HTTPS
     
Verifying SSL Support. Please wait...
Common Name: lawfirmmarketingexperts.com
Organization:
Location:
Issuer: YR2
Valid from: Jul 16 19:00:36 2026 GMT
Valid until: Oct 14 19:00:35 2026 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: YR2
Organization: Let's Encrypt
Location: US
Issuer: Root YR
Valid from: Sep 3 00:00:00 2025 GMT
Valid until: Sep 2 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: Root YR
Organization: ISRG
Location: US
Issuer: ISRG Root X1
Valid from: May 13 00:00:00 2026 GMT
Valid until: Sep 2 23:59:59 2032 GMT
Authority: CA:TRUE
Keysize: 4096 Bits

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 criminaldefenselawyermarketing.com supports HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
content-type: text/html; charset=utf-8
date: Sun, 02 Aug 2026 14:07:02 GMT
location: https://lawfirmmarketingexperts.com
server: ip-100-74-5-144.eu-west-2.compute.internal
vary: Accept-Encoding
x-request-id: 40be8686-f88c-4bfb-93f7-09059ac732de
content-length: 58

HTTP/2 200 
server: nginx
date: Sun, 02 Aug 2026 14:07:02 GMT
content-type: text/html; charset=UTF-8
content-length: 23531
x-powered-by: PHP/8.3.32
last-modified: Sun, 02 Aug 2026 13:52:08 GMT
vary: Accept-Encoding
content-encoding: gzip
strict-transport-security: max-age=15768000; includeSubDomains
x-powered-by: PleskLin

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
A 15.197.225.128 3600
A 3.33.251.168 3600
NS ns04.domaincontrol.com 3600
NS ns03.domaincontrol.com 3600
SOA 3600
Mname ns03.domaincontrol.com
Rname dns.jomax.net
Serial Number 2026061005
Refresh 28800
Retry 7200
Expire 604800
Minimum TTL 600

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 26, 2023 and will expire on June 26, 2027 if not renewed. This website is now assigned through the registrar GoDaddy.com, LLC. The WHOIS data for this website's domain was last updated on June 27, 2025.
Domain Created:
2023-06-26
Domain Expires:
2027-06-26
Domain Updated:
2025-06-27
Domain Age:
3 years 1 months 6 days
Domain Registrar:
GoDaddy.com, LLC
WhoIs:
 

   Domain Name: CRIMINALDEFENSELAWYERMARKETING.COM
   Registry Domain ID: 2793571228_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.godaddy.com
   Registrar URL: http://www.godaddy.com
   Updated Date: 2025-06-27T13:04:21Z
   Creation Date: 2023-06-26T15:23:03Z
   Registry Expiry Date: 2027-06-26T15:23:03Z
   Registrar: GoDaddy.com, LLC
   Registrar IANA ID: 146
   Registrar Abuse Contact Email: email
   Registrar Abuse Contact Phone: 480-624-2505
   Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
   Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
   Name Server: NS03.DOMAINCONTROL.COM
   Name Server: NS04.DOMAINCONTROL.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2026-08-02T14:07:20Z