Criminaldefenselawyermarketing.com
Law Firm Marketing Experts - Digital Marketing Agency for Lawyers
Domain Summary
What IP addresses does Criminaldefenselawyermarketing.com resolve to?
• Criminaldefenselawyermarketing.com resolves to the IP addresses 15.197.225.128.
Where are Criminaldefenselawyermarketing.com servers located in?
• Criminaldefenselawyermarketing.com has servers located in United States.
criminaldefenselawyermarketing.com Profile
Title:Law Firm Marketing Experts - Digital Marketing Agency for Lawyers
Description:Experienced, reliable law firm marketing agency specializing in digital marketing and web design for solo lawyers and law firms.
What technologies does criminaldefenselawyermarketing.com use?
These are the technologies used at criminaldefenselawyermarketing.com. criminaldefenselawyermarketing.com has a total of 13 technologies installed in 15 different categories.criminaldefenselawyermarketing.com Traffic Analysis
There's no enough data about criminaldefenselawyermarketing.com traffic.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- n/a
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- criminaldefenselawyermarketing.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Backlinks Report ▼
Criminaldefenselawyermarketing.com has a total of 210 backlinks from 105 referring domains and most of them comes from Singapore.- Total Backlinks:
- 210
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 105
- Referring IPs:
- 47
- Authority Domain Score:
- 2
Backlinks by country
- Country
- Domains
- Singapore 68
- Moldova 13
- France 7
- United States 4
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 36
- .in
- 12
- .top
- 6
- .edu
- 0
- .gov
- 0
Last update was 45 mins ago
This can take up to 60 seconds. Please wait...
Update will be available in 24 hours
This can take up to 60 seconds. Please wait...
Update will be available in 24 hours
*HypeStat.com is not promoting or affiliated with criminaldefenselawyermarketing.com in any way. Only publicly available statistics data are displayed.
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- criminaldefenselawyermarketing.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- criminaldefenselawyermarketing.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- criminaldefenselawyermarketing.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is criminaldefenselawyermarketing.com hosted? ▼
Criminaldefenselawyermarketing.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 15.197.225.128
- ASN:
- AS16509
- ISP:
- Amazon.com, Inc.
- Server Location:
United States, US
Other sites hosted on 15.197.225.128
How fast does criminaldefenselawyermarketing.com load? ▼
The average loading time of criminaldefenselawyermarketing.com is 821 ms. The Desktop speed index is 0 and mobile speed index is 85.- Average Load Time:
- 821 ms
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Largest Contentful Paint 3.4 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Time to Interactive 3.4 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Max Potential First Input Delay 20 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
First Contentful Paint 3.4 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Speed Index 3.4 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Total Blocking Time 0 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Does criminaldefenselawyermarketing.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on criminaldefenselawyermarketing.com are reduced by 76%.
criminaldefenselawyermarketing.com use gzip compression.
Original size: 97.76 KB
Compressed size: 22.98 KB
File reduced by: 74.78 KB (76%)
Compressed size: 22.98 KB
File reduced by: 74.78 KB (76%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. criminaldefenselawyermarketing.com supports HTTPS. criminaldefenselawyermarketing.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: lawfirmmarketingexperts.com
Organization:
Location:
Issuer: YR2
Valid from: Jul 16 19:00:36 2026 GMT
Valid until: Oct 14 19:00:35 2026 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: YR2
Valid from: Jul 16 19:00:36 2026 GMT
Valid until: Oct 14 19:00:35 2026 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: YR2
Organization: Let's Encrypt
Location: US
Issuer: Root YR
Valid from: Sep 3 00:00:00 2025 GMT
Valid until: Sep 2 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: Root YR
Valid from: Sep 3 00:00:00 2025 GMT
Valid until: Sep 2 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: Root YR
Organization: ISRG
Location: US
Issuer: ISRG Root X1
Valid from: May 13 00:00:00 2026 GMT
Valid until: Sep 2 23:59:59 2032 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: ISRG
Location: US
Issuer: ISRG Root X1
Valid from: May 13 00:00:00 2026 GMT
Valid until: Sep 2 23:59:59 2032 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. criminaldefenselawyermarketing.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.content-type: text/html; charset=utf-8
date: Sun, 02 Aug 2026 14:07:02 GMT
location: https://lawfirmmarketingexperts.com
server: ip-100-74-5-144.eu-west-2.compute.internal
vary: Accept-Encoding
x-request-id: 40be8686-f88c-4bfb-93f7-09059ac732de
content-length: 58
HTTP/2 200
server: nginx
date: Sun, 02 Aug 2026 14:07:02 GMT
content-type: text/html; charset=UTF-8
content-length: 23531
x-powered-by: PHP/8.3.32
last-modified: Sun, 02 Aug 2026 13:52:08 GMT
vary: Accept-Encoding
content-encoding: gzip
strict-transport-security: max-age=15768000; includeSubDomains
x-powered-by: PleskLin
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| A | 15.197.225.128 | 3600 | |
| A | 3.33.251.168 | 3600 | |
| NS | 3600 | ||
| NS | 3600 | ||
| SOA | 3600 | ||
| Mname | ns03.domaincontrol.com | ||
| Rname | dns.jomax.net | ||
| Serial Number | 2026061005 | ||
| Refresh | 28800 | ||
| Retry | 7200 | ||
| Expire | 604800 | ||
| Minimum TTL | 600 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 26, 2023 and will expire on June 26, 2027 if not renewed. This website is now assigned through the registrar GoDaddy.com, LLC. The WHOIS data for this website's domain was last updated on June 27, 2025.- Domain Created:
- 2023-06-26
- Domain Expires:
- 2027-06-26
- Domain Updated:
- 2025-06-27
- Domain Age:
- 3 years 1 months 6 days
- Domain Registrar:
- GoDaddy.com, LLC
- WhoIs:
Domain Name: CRIMINALDEFENSELAWYERMARKETING.COM Registry Domain ID: 2793571228_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2025-06-27T13:04:21Z Creation Date: 2023-06-26T15:23:03Z Registry Expiry Date: 2027-06-26T15:23:03Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS03.DOMAINCONTROL.COM Name Server: NS04.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2026-08-02T14:07:20Z