washingtonpost.com Washingtonpost.com - Classifiedsmarketplace.washingtonpost.com

   
IPublish MarketPlace

Domain Summary

What percent of global Internet users visit Classifiedsmarketplace.washingtonpost.com?

2.2E-5% of global Internet users visit Classifiedsmarketplace.washingtonpost.com

How many people visit Classifiedsmarketplace.washingtonpost.com each day?

• Classifiedsmarketplace.washingtonpost.com receives approximately 1.1K visitors and 2,511 page impressions per day.

Which countries does Classifiedsmarketplace.washingtonpost.com receive most of its visitors from?

• Classifiedsmarketplace.washingtonpost.com is mostly visited by people located in United States,Japan,Philippines.

How much Classifiedsmarketplace.washingtonpost.com can earn?

• Classifiedsmarketplace.washingtonpost.com should earn about $11.30/day from advertising revenue.

What is Classifiedsmarketplace.washingtonpost.com estimated value?

• Estimated value of Classifiedsmarketplace.washingtonpost.com is $8,840.87.

What IP addresses does Classifiedsmarketplace.washingtonpost.com resolve to?

• Classifiedsmarketplace.washingtonpost.com resolves to the IP addresses 54.174.93.207.

Where are Classifiedsmarketplace.washingtonpost.com servers located in?

• Classifiedsmarketplace.washingtonpost.com has servers located in Ashburn, Virginia, 20149, United States.

classifiedsmarketplace.washingtonpost.com Profile

Title:iPublish MarketPlace Description:Create and schedule your classified advertisements for print and online. It's quick and cost-effective with AdPortal!
Tags:

What technologies does classifiedsmarketplace.washingtonpost.com use?

These are the technologies used at classifiedsmarketplace.washingtonpost.com. classifiedsmarketplace.washingtonpost.com has a total of 10 technologies installed in 7 different categories.

classifiedsmarketplace.washingtonpost.com Traffic Analysis

This website is viewed by an estimated 1.1K visitors daily, generating a total of 2.5K pageviews. This equates to about 32.8K monthly visitors.
Daily Visitors1.1K
Monthly Visits32.8K
Pages per Visit2.32
Visit duration00:22
Bounce Rate45.64%
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
1,083
Monthly Visits:
32,815
Pages per Visit:
2.32
Daily Pageviews:
2,511
Avg. visit duration:
00:22
Bounce rate:
45.64%
Global Reach:
2.2E-5%
Monthly Visits (SimilarWeb):
32,157
HypeRank:
n/a
*All traffic values are estimates only.

Total Visits Last 3 Months

360
FEB
32.8K
MAR
32.8K
APR

Visitors by country

Country
Users%
 
United States 90.04%
 
Japan 2.46%
 
Philippines 2.17%
 
India 1.80%
 
United Kingdom 0.99%
Last update was 167 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with washingtonpost.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  classifiedsmarketplace.washingtonpost.com
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Revenue report

Google.com would generate approximately $11.3 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $339 and annual gross revenue of approximately $4.1K. Based on these figures, the site's net worth is estimated at around $8.8K.

How much would classifiedsmarketplace.washingtonpost.com make?

Daily Revenue:
$11.30
Monthly Revenue:
$339.00
Yearly Revenue:
$4,124.50
*All earnings values are estimates only.

Daily earning by country

 
CountryPageviewsEarning
 
United States 2,261$10.92
 
United Kingdom 25$0.07
 
Japan 62$0.02
 
India 45$0.02
 
Philippines 54$0.01

Loss of money due to Adblock?

Daily Revenue Loss:
$1.98
Monthly Revenue Loss:
$59.48
Yearly Revenue Loss:
$723.66
Daily Pageviews Blocked:
429
Monthly Pageviews Blocked:
12,879
Yearly Pageviews Blocked:
156,698

Daily revenue loss by country

 
CountryBlockedLost Money
 
United States 407$1.97
 
United Kingdom 4$0.01
 
India 13$0.00
 
Philippines 4$0.00
 
Japan 2$0.00

How much is classifiedsmarketplace.washingtonpost.com worth?

Website Value:
$8.8K

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
washingtonpost.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
washingtonpost.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
washingtonpost.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is classifiedsmarketplace.washingtonpost.com hosted?

Classifiedsmarketplace.washingtonpost.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
54.174.93.207
ASN:
AS14618 
ISP:
Amazon.com, Inc. 
Server Location:
Ashburn
Virginia, VA
20149
United States, US
 

Other sites hosted on 54.174.93.207

There are no other sites hosted on this IP

How fast does classifiedsmarketplace.washingtonpost.com load?

The average loading time of classifiedsmarketplace.washingtonpost.com is 507 ms.
Average Load Time:
507 ms

Does classifiedsmarketplace.washingtonpost.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on classifiedsmarketplace.washingtonpost.com are reduced by 75%.
classifiedsmarketplace.washingtonpost.com use gzip compression.
Original size: 14.41 KB
Compressed size: 3.56 KB
File reduced by: 10.85 KB (75%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. classifiedsmarketplace.washingtonpost.com supports HTTPS.
 classifiedsmarketplace.washingtonpost.com supports HTTPS
     
Verifying SSL Support. Please wait...
Common Name: classifiedsmarketplace.washingtonpost.com
Organization: WP Company LLC
Location: District of Columbia, US
Issuer: Entrust OV TLS Issuing RSA CA 2
Valid from: May 22 00:00:00 2025 GMT
Valid until: Jun 22 23:59:59 2026 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: USERTrust RSA Certification Authority
Organization: The USERTRUST Network
Location: Jersey City, New Jersey, US
Issuer: USERTrust RSA Certification Authority
Valid from: Feb 1 00:00:00 2010 GMT
Valid until: Jan 18 23:59:59 2038 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Common Name: Sectigo Public Server Authentication Root R46
Organization: Sectigo Limited
Location: GB
Issuer: USERTrust RSA Certification Authority
Valid from: Mar 22 00:00:00 2021 GMT
Valid until: Jan 18 23:59:59 2038 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Common Name: Entrust OV TLS Issuing RSA CA 2
Organization: Entrust Limited
Location: CA
Issuer: Sectigo Public Server Authentication Root R46
Valid from: Dec 11 00:00:00 2024 GMT
Valid until: Dec 10 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 3072 Bits
Common Name: classifiedsmarketplace.washingtonpost.com
Organization: WP Company LLC
Location: District of Columbia, US
Issuer: Entrust OV TLS Issuing RSA CA 2
Valid from: May 22 00:00:00 2025 GMT
Valid until: Jun 22 23:59:59 2026 GMT
Authority: CA:FALSE
Keysize: 2048 Bits

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 classifiedsmarketplace.washingtonpost.com supports HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
date: Wed, 04 Jun 2025 03:06:03 GMT
content-type: text/html;charset=UTF-8
server: Apache
cache-control: no-cache, no-store, max-age=0, must-revalidate
pragma: no-cache
expires: 0
strict-transport-security: max-age=31536000 ; includeSubDomains
x-xss-protection: 1; mode=block
x-frame-options: DENY
x-content-type-options: nosniff
set-cookie: JSESSIONID=37B7F7CC127BC2C4ADA262DF31BE0E00; Path=/; Secure; HttpOnly
content-language: en-US
vary: Accept-Encoding
content-encoding: gzip

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
CNAME twp.ipublishmarketplace.com 43200