Chryslerkeyreplacementwaldorf.com
Chrysler Key Replacement - 24/7 Cheap Locksmith Service
Domain Summary
What IP addresses does Chryslerkeyreplacementwaldorf.com resolve to?
• Chryslerkeyreplacementwaldorf.com resolves to the IP addresses 184.168.23.107.
Where are Chryslerkeyreplacementwaldorf.com servers located in?
• Chryslerkeyreplacementwaldorf.com has servers located in United States.
chryslerkeyreplacementwaldorf.com Profile
Title:Chrysler Key Replacement - 24/7 Cheap Locksmith Service
Description: Chrysler Key Replacement offers professional, trusted, and cheap locksmith service in Waldorf, MD, and we’re available day and night for it.
Tags:
What technologies does chryslerkeyreplacementwaldorf.com use?
These are the technologies used at chryslerkeyreplacementwaldorf.com. chryslerkeyreplacementwaldorf.com has a total of 5 technologies installed in 6 different categories.chryslerkeyreplacementwaldorf.com Traffic Analysis
There's no enough data about chryslerkeyreplacementwaldorf.com traffic.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- n/a
- SEMrush Rank:
- 20,060,044
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- chryslerkeyreplacementwaldorf.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 20,060,044
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 5
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Backlinks Report ▼
Chryslerkeyreplacementwaldorf.com has a total of 173 backlinks from 91 referring domains and most of them comes from Singapore.- Total Backlinks:
- 173
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 91
- Referring IPs:
- 26
- Authority Domain Score:
- 2
Backlinks by country
- Country
- Domains
- Singapore 55
- Moldova 14
- France 8
- United States 6
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 26
- .in
- 10
- .top
- 6
- .edu
- 0
- .gov
- 0
Last update was 46 mins ago
This can take up to 60 seconds. Please wait...
Update will be available in 24 hours
This can take up to 60 seconds. Please wait...
Update will be available in 24 hours
*HypeStat.com is not promoting or affiliated with chryslerkeyreplacementwaldorf.com in any way. Only publicly available statistics data are displayed.
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- chryslerkeyreplacementwaldorf.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- chryslerkeyreplacementwaldorf.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- chryslerkeyreplacementwaldorf.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is chryslerkeyreplacementwaldorf.com hosted? ▼
Chryslerkeyreplacementwaldorf.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 184.168.23.107
- ASN:
- AS398101
- ISP:
- GO-DADDY-COM-LLC
- Server Location:
United States, US
Other sites hosted on 184.168.23.107
There are no other sites hosted on this IPHow fast does chryslerkeyreplacementwaldorf.com load? ▼
The average loading time of chryslerkeyreplacementwaldorf.com is 735 ms.- Average Load Time:
- 735 ms
Does chryslerkeyreplacementwaldorf.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on chryslerkeyreplacementwaldorf.com are reduced by 68%.
chryslerkeyreplacementwaldorf.com use gzip compression.
Original size: 18.06 KB
Compressed size: 5.62 KB
File reduced by: 12.44 KB (68%)
Compressed size: 5.62 KB
File reduced by: 12.44 KB (68%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. chryslerkeyreplacementwaldorf.com supports HTTPS. chryslerkeyreplacementwaldorf.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: chryslerkeyreplacementwaldorf.com
Organization:
Location:
Issuer: YR2
Valid from: Jun 21 13:14:53 2026 GMT
Valid until: Sep 19 13:14:52 2026 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: YR2
Valid from: Jun 21 13:14:53 2026 GMT
Valid until: Sep 19 13:14:52 2026 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: YR2
Organization: Let's Encrypt
Location: US
Issuer: Root YR
Valid from: Sep 3 00:00:00 2025 GMT
Valid until: Sep 2 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: Root YR
Valid from: Sep 3 00:00:00 2025 GMT
Valid until: Sep 2 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: Root YR
Organization: ISRG
Location: US
Issuer: ISRG Root X1
Valid from: May 13 00:00:00 2026 GMT
Valid until: Sep 2 23:59:59 2032 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: ISRG
Location: US
Issuer: ISRG Root X1
Valid from: May 13 00:00:00 2026 GMT
Valid until: Sep 2 23:59:59 2032 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. chryslerkeyreplacementwaldorf.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.server: nginx
date: Thu, 02 Jul 2026 13:44:03 GMT
content-type: text/html; charset=utf-8
vary: Accept-Encoding
last-modified: Tue, 25 Nov 2025 09:32:38 GMT
cache-control: max-age=604800
expires: Thu, 09 Jul 2026 13:44:03 GMT
vary: Accept-Encoding,User-Agent
content-encoding: gzip
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| A | 184.168.23.107 | 14367 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on November 15, 2022 and will expire on November 15, 2026 if not renewed. This website is now assigned through the registrar GoDaddy.com, LLC. The WHOIS data for this website's domain was last updated on November 9, 2025.- Domain Created:
- 2022-11-15
- Domain Expires:
- 2026-11-15
- Domain Updated:
- 2025-11-09
- Domain Age:
- 3 years 7 months 17 days
- Domain Registrar:
- GoDaddy.com, LLC
- WhoIs:
Domain Name: CHRYSLERKEYREPLACEMENTWALDORF.COM Registry Domain ID: 2738659274_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2025-11-09T17:26:26Z Creation Date: 2022-11-15T14:13:06Z Registry Expiry Date: 2026-11-15T14:13:06Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS1.RISINGSUNHOSTING.COM Name Server: NS2.RISINGSUNHOSTING.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2026-07-02T13:44:27Z