All Analyzed Sites - 27.6M

Tienda Solsta - Licencias de Software PV*SOL y capacitaciones – Solsta Shop
tienda.solsta.co
246 days ago
Ville de Courthézon
courthezon.fr
246 days ago
DIKA CLOTHING STORE – Dika Clothing Store
shop.dikaclothingstore.com
Somos una marca de ropa Colombiana creada para resaltar la belleza de la mujer, basándonos en las características de cada persona para garantizar prendas únicas como vestidos de baño, pantalones, camisas, vestidos, blusas.
246 days ago
Chipka Ke Bol – Shop Online In India for Stickers,Mugs,Fridge Magnets,Notebooks for professionals,Sports and Humour
chipkakebol.com
246 days ago
Top Producing Real Estate Agents in North County, San Diego
pivotca.com
Pivot Real Estate is part top-producing collective of expert Realtors®️ and part boutique, tech-forward team headquartered in Escondido, CA
246 days ago
DONE
shop.donedone.io
246 days ago
Hero Store Colombia
colombia.h***tore.co
La tienda oficial de Pequeños Héroes y Hero Moms en Colombia.
246 days ago
AceleraTI
checkout.acelerati.co
246 days ago
MTD Parts Canada | Browse our wide selection of parts for outdoor power equipment!
chippershredders.ca
Searching for belts, blades or filters to repair your outdoor power equipment? Use our Part Finder tool to quickly and easily find the right parts!
246 days ago
Bambi Medical | Making babies' lives happier from day one
bambi-medical.com
Bambi Medical makes babies’ lives happier from day one by developing, testing and producing new technologies for the NICU, such as the Bambi Belt.
246 days ago
Bitácoras| Álbumes para guardar tus recuerdos | Cromafoto
tienda.cromafotodigital.com
Las mejores bitacoras de viajes, parejas, el libro de las 100 citas mejorado, de gatitos, de perritos, para sus conciertos, para todo momento. Tu creas recuerdos, nosotros los guardamos ✨
246 days ago
Home | Rotary Club of Sacramento
rotarysacramento.com
Rotary Club of Sacramento | Our club is the 97th club in the world of Rotary International and one of the oldest service groups in the Sacramento region.
246 days ago
The Naming Group | Brand Naming Agency | Changing the Way Brands Name
thenaminggroup.com
The Naming Group is an eclectic team of linguists, strategists, IP attorneys, professional namers & industry experts – custom assigned to each engagement.
246 days ago
EzyDog Colombia | 🥇 EzyDog Articulos para Perros en Colombia
checkout.ezydog.co
🥇 EzyDog ▷ Equipos para perros construido para mantener a su cachorro sano y feliz. Los productos incluyen correas para perros, collares, arneses para perros, mochilas para mascotas y correas que absorben los golpes. Ven y Visítanos.
246 days ago
Ethos Active | Ropa Deportiva para Mujer – ethosactive
colombia.ethosactive.com.co
Marca Colombiana de ropa deportiva que busca combinar la moda de la calle con la comodidad del gimnasio. Encuentra Leggins, Tops y Accesorios deportivos.
246 days ago
DALIBRO - Photography | Travel | Adventures
dalibro.com
Blog about photography, travelling, tips and tricks interleaved with coffee, nerdy stuff about camera gear and occasional adventures.
246 days ago
Prin***les noticias del futbol internacional, actualidad y ultimas noticias de deportes - Clonapine TV
clonapine.com
246 days ago
Grupo Effi Col
tiendaco.grupoeffi.com
246 days ago
Home | Advanced Chippewa Technologies Inc.
chippewa.ca
246 days ago
Celebrities Store USA
celebritiesstore.us
246 days ago
Chippewa Lake Dryer Vent Cleaning (330) 443-2237 Call us 24/7
chippewalakedryerventcleaning.us
Dryer Vent Cleaning in Chippewa Lake OH (330) 443-2237 Find local pros ready to tackle it and book them with our Chippewa Lake Dryer Vent Cleaning service
246 days ago
herob88.online
246 days ago
Parking Page
herobet88.life
246 days ago
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
glamura.co
Shopify provides a reliable Ecommerce platform so you focus on selling online! Integrated hosting, shopping cart and Ecommerce payment solution all in one!
246 days ago
LAURENTINA
laurentina.com.co
246 days ago
Think It Up - Entertainment Industry Foundation
thinkitup.org
Think It Up was national education initiative founded by EIF and the XQ Institute to reframe the public discussion about education in America.
246 days ago
Chippewa Lake Garage door repair (330) 443-2241 Call us 24/7
chippewalakegaragedoorrepair.us
Garage Door Repair in Chippewa Lake. (330) 443-2241 Find a service provider all over the city 24/7, and we are ready to help you in research the pros for any situation that may happen
246 days ago
403 Forbidden
bazar24.co
246 days ago
Just a moment...
herobet88.pro
246 days ago
Parking Page
herobet88.network
246 days ago
Se lo Tengo – selotengo shop
selotengo.co
Somos una empresa importadora y comercializadora de artículos para el hogar, belleza, electrodomésticos y tecnología.
246 days ago
Classic Improvement Products | Serving Orange County & Los Angeles County
chiproducts.us
Classic Improvement Products of Anaheim Hills, California offers sales, installation and service throughout Southern California. Our product line includes Motorized Power Screens, Retractable Screen Doors, Closet Doors, Shades, Blinds, Interior Plantation Shutters, Exterior Shutters, Rolling Shutters, Bahama Shutters, Room Dividers, Wall Slides, and Awnings.
246 days ago
Parked Domain name on Hostinger DNS system
herobet88.store
Parked Domain name on Hostinger DNS system
246 days ago
Just a moment...
herobet88.click
246 days ago
Chique & Unique // Upscale Resale Boutique – CHIQUE & UNIQUE
chiqueandunique.ca
246 days ago
n8n.io - Workflow Automation
gvk.com.co
246 days ago
Parking Page
herobet88.guru
246 days ago
Sophisttech - Productos Tecnológicos – Store Sophisttech
store.sophisttech.com
"Descubre la última tecnología innovadora en Sophisttech. Ofrecemos una amplia gama de productos tecnológicos de vanguardia, desde gadgets inteligentes hasta dispositivos electrónicos de última generación. Compra ahora y lleva la innovación a tu vida."
246 days ago
VanitySh0p
vanityshop.co
246 days ago
Mara Suttmann-Lea
marasuttmannlea.com
246 days ago
Clinique Chiropratique | Chiro-Clinique Rock Forest | Québec
chiroclinique.ca
Chiroclinique rock forest, chiropratique et massothérapie
246 days ago
BIOAQUA - Colombia– Bioaqua
bioaqua.co
BIOAQUA es un es un universo donde mujeres y hombres no tienen miedo a dedic*** un tiempo para Cuid***, Encuentras productos para el cuidado facial, maquillaje, cuidado para el cabello y protección solar recomendados por dermatólogos.
246 days ago
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
mundoshop.me
Shopify provides a reliable Ecommerce platform so you focus on selling online! Integrated hosting, shopping cart and Ecommerce payment solution all in one!
246 days ago
403 Forbidden
intecorept.com
246 days ago
Clinique Chiropratique des Coteaux - Accueil
chirodescoteaux.ca
246 days ago
Home - Christine Dürschner
christineduerschner.net
Discover the ultimate Life Coach website built using Avada. Empower your journey with customizable tools designed to elevate your coaching experience.
246 days ago
Féileacáin - Stillbirth and Neonatal *** Support
feileacain.ie
Féileacáin was formed by a group of bereaved parents to offer support to anyone affected by the *** of a baby around the time of birth.
246 days ago
Accueil | Chiro Estrie - Clinique familiale et sportive
chiroestrie.ca
Libérez-vous de votre douleur et retrouvez une qualité de vie. Chiro Estrie est une clinique chiropratique familiale et sportive offrant ses services à Sherbrooke et à Bromptonville.
246 days ago
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
thelu***.com.co
Shopify provides a reliable Ecommerce platform so you focus on selling online! Integrated hosting, shopping cart and Ecommerce payment solution all in one!
54 days ago
Attention Required! | Cloudflare
cdn.midjourney.com
246 days ago