Walkervilleandsavannacitytimes.co.za

Q: What is the traffic rank for Walkervilleandsavannacitytimes.co.za?

Walkervilleandsavannacitytimes.co.za ranks 6,488,235 globally on HypeStat.

Q: What percent of global Internet users visit Walkervilleandsavannacitytimes.co.za?

2.0E-6% of global Internet users visit Walkervilleandsavannacitytimes.co.za.

Q: How much Walkervilleandsavannacitytimes.co.za can earn?

Walkervilleandsavannacitytimes.co.za should earn about $0.05 /day from advertising revenue.

Q: What is Walkervilleandsavannacitytimes.co.za estimated value?

Estimated value of Walkervilleandsavannacitytimes.co.za is $44.33 .

Walkerville & Savanna City Times -

Domain Summary

What is the traffic rank for Walkervilleandsavannacitytimes.co.za?

• Walkervilleandsavannacitytimes.co.za ranks #6,488,235 globally on HypeStat.

What percent of global Internet users visit Walkervilleandsavannacitytimes.co.za?

• 2.0E-6% of global Internet users visit Walkervilleandsavannacitytimes.co.za

How many people visit Walkervilleandsavannacitytimes.co.za each day?

• Walkervilleandsavannacitytimes.co.za receives approximately 99 visitors and 30 page impressions per day.

Which countries does Walkervilleandsavannacitytimes.co.za receive most of its visitors from?

• Walkervilleandsavannacitytimes.co.za is mostly visited by people located in Belgium,Canada,Germany.

How much Walkervilleandsavannacitytimes.co.za can earn?

• Walkervilleandsavannacitytimes.co.za should earn about $0.05/day from advertising revenue.

What is Walkervilleandsavannacitytimes.co.za estimated value?

• Estimated value of Walkervilleandsavannacitytimes.co.za is $44.33.

What IP addresses does Walkervilleandsavannacitytimes.co.za resolve to?

• Walkervilleandsavannacitytimes.co.za resolves to the IP addresses 196.22.142.65.

Where are Walkervilleandsavannacitytimes.co.za servers located in?

• Walkervilleandsavannacitytimes.co.za has servers located in South Africa.

walkervilleandsavannacitytimes.co.za Profile

Title:Walkerville & Savanna City Times -

Edit Site Info

What technologies does walkervilleandsavannacitytimes.co.za use?

These are the technologies used at walkervilleandsavannacitytimes.co.za. walkervilleandsavannacitytimes.co.za has a total of 16 technologies installed in 14 different categories.

Widgets

AddToAny

WordPress plugins

AddToAny Share Buttons

Site Kit

Yoast SEO

Web Servers

Apache HTTP Server

WordPress themes

ColorMag

ThemeGrill ColorMag

Advertising

Google AdSense

Analytics

Google Analytics

Site Kit

JavaScript Libraries

jQuery

jQuery Migrate

Miscellaneous

Open Graph

Performance

Priority Hints

CMS

WordPress

Blogs

WordPress

SEO

Yoast SEO

Programming Languages

PHP

Databases

MySQL

walkervilleandsavannacitytimes.co.za Traffic Analysis

Walkervilleandsavannacitytimes.co.za is ranked #6,488,235 in the world. This website is viewed by an estimated 99 visitors daily, generating a total of 30 pageviews. This equates to about 3K monthly visitors.

Daily Visitors99

Monthly Visits3K

Pages per Visit0.30

Visit duration05:59

Bounce Rate17.53%

Is this your site?Verify your site's metrics.

Daily Unique Visitors:: 99
Monthly Visits:: 3,000
Pages per Visit:: 0.30
Daily Pageviews:: 30

Avg. visit duration:: 05:59
Bounce rate:: 17.53%
Global Reach:: 2.0E-6%
Monthly Visits (SimilarWeb):: 3,040
HypeRank:: 6,488,235
SEMrush Rank:: 21,083,597
SimilarWeb Rank:: 10,769,966

*All traffic values are estimates only.

Total Visits Last 3 Months

570

NOV

DEC

JAN

Visitors by country

Country: Users%
: Belgium 21.04%
: Canada 20.49%
: Germany 19.85%
: South Africa 19.65%
: Portugal 18.97%

Backlinks Report ▼

Walkervilleandsavannacitytimes.co.za has a total of 10 backlinks from 1 referring domains and most of them comes from United States.

Total Backlinks:: 10
Follow Links:: n/a
Nofollow Links:: n/a
Referring Domains:: 1
Referring IPs:: 2
Authority Domain Score:: 6

Backlinks by country

Country: Domains
: United States 1

Backlinks by TLDs

TLD Distribution: Domains
.com: 1
.edu: 0
.gov: 0

Last update was 58 days ago

This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with walkervilleandsavannacitytimes.co.za in any way. Only publicly available statistics data are displayed.

Search Engine Indexes ▼

Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.

Google Index:: 243

▼

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.

Domain:: walkervilleandsavannacitytimes.co.za
Rank: (Rank based on keywords, cost and organic traffic): 21,083,597
Organic Keywords: (Number of keywords in top 20 Google SERP): 4
Organic Traffic: (Number of visitors coming from top 20 search results): 0
Organic Cost: ((How much need to spend if get same number of visitors from Google Adwords): $0.00

Full SEMrush Report >>

Revenue report ▼

Google.com would generate approximately $0.1 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $1.5 and annual gross revenue of approximately $18.3. Based on these figures, the site's net worth is estimated at around $44.3.

How much would walkervilleandsavannacitytimes.co.za make?

Daily Revenue:: $0.05
Monthly Revenue:: $1.50
Yearly Revenue:: $18.25

*All earnings values are estimates only.

Daily earning by country

: CountryPageviewsEarning
: Canada 6$0.04
: Germany 6$0.01
: South Africa 6$0.00
: Belgium 6$0.00
: Portugal 6$0.00

Loss of money due to Adblock?

Daily Revenue Loss:: $0.01
Monthly Revenue Loss:: $0.37
Yearly Revenue Loss:: $4.55
Daily Pageviews Blocked:: 5
Monthly Pageviews Blocked:: 160
Yearly Pageviews Blocked:: 1,947

Daily revenue loss by country

: CountryBlockedLost Money
: Canada 2$0.01
: Germany 2$0.00
: Belgium 1$0.00
: Portugal 1$0.00
: South Africa 0$0.00

How much is walkervilleandsavannacitytimes.co.za worth?

Website Value:: $44.3

Ad Experience Report ▼

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:: walkervilleandsavannacitytimes.co.za
Ad filtering: (Chrome is not filtering ads on your site.): Off
Status: (The status of the site that is reviewed for the Better Ads Standards.): Not reviewed

Desktop summary

Root domain:: walkervilleandsavannacitytimes.co.za
Ad filtering: (Chrome is not filtering ads on your site.): Off
Status: (The status of the site that is reviewed for the Better Ads Standards.): Not reviewed

Abusive Experience Report ▼

Summary of the abusive experience rating of a website.

Root domain:: walkervilleandsavannacitytimes.co.za
Enforcement: (Chrome is not preventing your site from opening new windows or tabs.): Off
Status: (The status of the site reviewed for the abusive experiences.): Not reviewed

Where is walkervilleandsavannacitytimes.co.za hosted? ▼

Walkervilleandsavannacitytimes.co.za may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.

Server IP:: 196.22.142.65
ASN:: AS37153
ISP:: HETZNER
Server Location:: South Africa, ZA

Other sites hosted on 196.22.142.65

businesstraveller.co.za

xpresspr.co.za

paarldeville.co.za

theworkspace.co.za

clghygienesupplies.co.za

chemicorp.co.za

globepost.co.za

orangefarmnews.co.za

How fast does walkervilleandsavannacitytimes.co.za load? ▼

The average loading time of walkervilleandsavannacitytimes.co.za is 1889 ms.

Average Load Time:: 1889 ms

Does walkervilleandsavannacitytimes.co.za use compression? ▼

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on walkervilleandsavannacitytimes.co.za are reduced by 87%.

walkervilleandsavannacitytimes.co.za use gzip compression.

Original size: 170.73 KB
Compressed size: 21.66 KB
File reduced by: 149.07 KB (87%)

Google Safe Browsing ▼

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.

This site is not currently listed as suspicious

MyWot.com Reputation Ratings

MyWOT (short for "My Web of Trust") is a web-based reputation and rating service that provides users with information about the trustworthiness and safety of websites.

Status:: NOT_SAFE

SSL Checker - SSL Certificate Verify ▼

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. walkervilleandsavannacitytimes.co.za supports HTTPS.

walkervilleandsavannacitytimes.co.za supports HTTPS

Verifying SSL Support. Please wait...

Common Name: walkervilleandsavannacitytimes.co.za
Organization:
Location:
Issuer: R3
Valid from: Feb 25 09:09:27 2024 GMT
Valid until: May 25 09:09:26 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits

Common Name: R3
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits

Verify HTTP/2 Support ▼

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.

walkervilleandsavannacitytimes.co.za supports HTTP/2

Verifying HTTP/2.0 Support. Please wait...

Http Header ▼

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.

link: <https://walkervilleandsavannacitytimes.co.za/wp-json/>; rel="https://api.w.org/"
vary: Accept-Encoding
content-encoding: gzip
content-length: 22177
content-type: text/html; charset=UTF-8
date: Thu, 29 Feb 2024 16:46:47 GMT
server: Apache

DNS Lookup ▼

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.

Type	Ip	Target/Txt	TTL
SOA			7200
	Mname	ns1.host-h.net
	Rname	postmaster.walkervilleandsavannacitytimes.co.za
	Serial Number	2023030801
	Refresh	86400
	Retry	1800
	Expire	3600000
	Minimum TTL	86400
MX		mail.walkervilleandsavannacitytimes.co.za	7200
A	196.22.142.65		7090
NS		ns2.dns-h.com	7101
NS		ns1.host-h.net	7101
NS		ns1.dns-h.com	7101
NS		ns2.host-h.net	7101

Whois Lookup ▼

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on March 6, 2023 and will expire on March 6, 2024 if not renewed. This website is now assigned through the registrar xneelo (Pty) Ltd. The WHOIS data for this website's domain was last updated on September 5, 2023.

Domain Created:: 2023-03-06
Domain Expires:: 2024-03-06
Domain Updated:: 2023-09-05
Domain Age:: 1 years 1 months 22 days
Domain Registrar:: xneelo (Pty) Ltd
Domain Owner:: None
WhoIs:

Domain Name: walkervilleandsavannacitytimes.co.za
Registry Domain ID: dom_41JCV--1
Registrar WHOIS Server:
Registrar URL: https://xneelo.co.za/
Updated Date: 2023-09-05T07:21:03Z
Creation Date: 2023-03-06T15:59:53Z
Registry Expiry Date: 2024-03-06T15:59:53Z
Registrar Registration Expiration Date: 2024-03-06T15:59:53Z
Registrar: xneelo (Pty) Ltd
Registrar Abuse Contact Email: 
Registrar Abuse Contact Phone: +27.219702000
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: None
Registrant Country: ZA
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin or Tech contacts of the domain name.
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin or Tech contacts of the domain name.
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin or Tech contacts of the domain name.
Billing Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin or Tech contacts of the domain name.
Name Server: ns2.host-h.net
Name Server: ns1.dns-h.com
Name Server: ns1.host-h.net
Name Server: ns2.dns-h.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2024-02-29T16:48:23Z