Vashikaranspecialistgyaniramji.com
Vashikaran specialist in India | Free Call at +91-9560409844
Domain Summary
What is the traffic rank for Vashikaranspecialistgyaniramji.com?
• Vashikaranspecialistgyaniramji.com ranks #4,921,595 globally on HypeStat.
What percent of global Internet users visit Vashikaranspecialistgyaniramji.com?
• 2.6E-5% of global Internet users visit Vashikaranspecialistgyaniramji.com
How many people visit Vashikaranspecialistgyaniramji.com each day?
• Vashikaranspecialistgyaniramji.com receives approximately 1.3K visitors and 2,564 page impressions per day.
Which countries does Vashikaranspecialistgyaniramji.com receive most of its visitors from?
• Vashikaranspecialistgyaniramji.com is mostly visited by people located in India.
How much Vashikaranspecialistgyaniramji.com can earn?
• Vashikaranspecialistgyaniramji.com should earn about $0.97/day from advertising revenue.
What is Vashikaranspecialistgyaniramji.com estimated value?
• Estimated value of Vashikaranspecialistgyaniramji.com is $845.06.
What IP addresses does Vashikaranspecialistgyaniramji.com resolve to?
• Vashikaranspecialistgyaniramji.com resolves to the IP addresses 216.10.240.60.
Where are Vashikaranspecialistgyaniramji.com servers located in?
• Vashikaranspecialistgyaniramji.com has servers located in India.
vashikaranspecialistgyaniramji.com Profile
Title:Vashikaran specialist in India | Free Call at +91-9560409844
What technologies does vashikaranspecialistgyaniramji.com use?
These are the technologies used at vashikaranspecialistgyaniramji.com. vashikaranspecialistgyaniramji.com has a total of 9 technologies installed in 8 different categories.vashikaranspecialistgyaniramji.com Traffic Analysis
Vashikaranspecialistgyaniramji.com is ranked #4,921,595 in the world. This website is viewed by an estimated 1.3K visitors daily, generating a total of 2.6K pageviews. This equates to about 38.8K monthly visitors.Daily Visitors1.3K
Monthly Visits38.8K
Pages per Visit2.00
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 1,282
- Monthly Visits:
- 38,845
- Pages per Visit:
- 2.00
- Daily Pageviews:
- 2,564
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- 2.6E-5%
- HypeRank:
- 4,921,595
Visitors by country
- Country
- Users%
- India 100.0%
Where do visitors go on vashikaranspecialistgyaniramji.com?
- Reach%Pageviews%PerUser
- vashikaranspecialistgyaniramji.com
- 100.00%100.00%2
Last update was 1566 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with vashikaranspecialistgyaniramji.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- vashikaranspecialistgyaniramji.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $1 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $29.1 and annual gross revenue of approximately $354.1. Based on these figures, the site's net worth is estimated at around $845.1.How much would vashikaranspecialistgyaniramji.com make?
- Daily Revenue:
- $0.97
- Monthly Revenue:
- $29.10
- Yearly Revenue:
- $354.05
Daily earning by country
- CountryPageviewsEarning
- India 2,564$0.97
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.27
- Monthly Revenue Loss:
- $8.18
- Yearly Revenue Loss:
- $99.58
- Daily Pageviews Blocked:
- 718
- Monthly Pageviews Blocked:
- 21,538
- Yearly Pageviews Blocked:
- 262,041
Daily revenue loss by country
- CountryBlockedLost Money
- India 718$0.27
How much is vashikaranspecialistgyaniramji.com worth?
- Website Value:
- $845.1
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- vashikaranspecialistgyaniramji.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- vashikaranspecialistgyaniramji.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- vashikaranspecialistgyaniramji.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is vashikaranspecialistgyaniramji.com hosted? ▼
Vashikaranspecialistgyaniramji.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 216.10.240.60
- ASN:
- AS394695
- ISP:
- PDR
- Server Location:
India, IN
Other sites hosted on 216.10.240.60
How fast does vashikaranspecialistgyaniramji.com load? ▼
The average loading time of vashikaranspecialistgyaniramji.com is 738 ms. The Desktop speed index is 36 and mobile speed index is 99.- Average Load Time:
- 738 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Lab Data
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Lab Data
Does vashikaranspecialistgyaniramji.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on vashikaranspecialistgyaniramji.com are reduced by 67%.
vashikaranspecialistgyaniramji.com use gzip compression.
Original size: 43.1 KB
Compressed size: 13.96 KB
File reduced by: 29.15 KB (67%)
Compressed size: 13.96 KB
File reduced by: 29.15 KB (67%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. vashikaranspecialistgyaniramji.com supports HTTPS. vashikaranspecialistgyaniramji.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: vashikaranspecialistgyaniramji.com
Organization:
Location:
Issuer: Let's Encrypt Authority X3
Valid from: Feb 4 01:55:47 2020 GMT
Valid until: May 4 01:55:47 2020 GMT
Authority:
Keysize:
Organization:
Location:
Issuer: Let's Encrypt Authority X3
Valid from: Feb 4 01:55:47 2020 GMT
Valid until: May 4 01:55:47 2020 GMT
Authority:
Keysize:
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. vashikaranspecialistgyaniramji.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Upgrade: h2c
Connection: Upgrade
HTTP/2 200
date: Thu, 01 Jan 1970 00:00:00 GMT
server: Apache/2.4.41 (cPanel) OpenSSL/1.1.1d mod_bwlimited/1.4 Phusion_Passenger/5.3.7
x-powered-by: PHP/5.6.40
vary: Accept-Encoding
content-encoding: gzip
content-length: 14290
content-type: text/html; charset=UTF-8
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
MX | 3600 | ||
SOA | 3600 | ||
Mname | ns1.cp-in-20.webhostbox.net | ||
Rname | cpanel.webhostbox.net | ||
Serial Number | 2019090500 | ||
Refresh | 3600 | ||
Retry | 7200 | ||
Expire | 1209600 | ||
Minimum TTL | 86400 | ||
TXT | 3600 | ||
A | 216.10.240.60 | 3562 | |
NS | 3562 | ||
NS | 3562 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on March 19, 2019 and will expire on June 18, 2024 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on June 18, 2024.- Domain Created:
- 2019-03-19
- Domain Age:
- 5 years 2 months 30 days
- WhoIs:
whois lookup at whois.PublicDomainRegistry.com...Domain Name: VASHIKARANSPECIALISTGYANIRAMJI.COM Registry Domain ID: 2370838036_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.publicdomainregistry.com Registrar URL: www.publicdomainregistry.com Updated Date: 2019-05-19T02:21:30Z Creation Date: 2019-03-19T13:15:45Z Registrar Registration Expiration Date: 2020-03-19T13:15:45Z Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Rajesh Kumar Registrant Organization: Daksha Technologies Registrant Street: SEO 84/3, Industrial Area, Phase V Registrant City: Mohali Registrant State/Province: Punjab Registrant Postal Code: 160055 Registrant Country: IN Registrant Phone: +91.9888923050 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email:Registry Admin ID: Not Available From Registry Admin Name: Rajesh Kumar Admin Organization: Daksha Technologies Admin Street: SEO 84/3, Industrial Area, Phase V Admin City: Mohali Admin State/Province: Punjab Admin Postal Code: 160055 Admin Country: IN Admin Phone: +91.9888923050 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email:
Registry Tech ID: Not Available From Registry Tech Name: Rajesh Kumar Tech Organization: Daksha Technologies Tech Street: SEO 84/3, Industrial Area, Phase V Tech City: Mohali Tech State/Province: Punjab Tech Postal Code: 160055 Tech Country: IN Tech Phone: +91.9888923050 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email:
Name Server: ns1.cp-in-20.webhostbox.net Name Server: ns2.cp-in-20.webhostbox.net DNSSEC: Unsigned Registrar Abuse Contact Email:
Registrar Abuse Contact Phone: +1.2013775952 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-03-05T02:52:39Z <<< For more information on Whois status codes, please visit https://icann.org/epp Registration Service Provided By: DAKSHA HOST The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is", and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. The Registrar of record is PDR Ltd. d/b/a PublicDomainRegistry.com. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms.whois lookup at whois.crsnic.net...Domain Name: VASHIKARANSPECIALISTGYANIRAMJI.COM Registry Domain ID: 2370838036_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.PublicDomainRegistry.com Registrar URL: http://www.publicdomainregistry.com Updated Date: 2019-03-22T09:44:09Z Creation Date: 2019-03-19T13:15:45Z Registry Expiry Date: 2020-03-19T13:15:45Z Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Registrar Abuse Contact Email:
Registrar Abuse Contact Phone: +1.2013775952 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS1.CP-IN-20.WEBHOSTBOX.NET Name Server: NS2.CP-IN-20.WEBHOSTBOX.NET DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2020-03-05T02:52:29Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.