Sreenarasimhaswamykshethrampala.net
ശ്രീ നരസിംഹ സ്വാമി ക്ഷേത്രംDomain Summary
What is the traffic rank for Sreenarasimhaswamykshethrampala.net?
• Sreenarasimhaswamykshethrampala.net ranks #7,574,623 globally on HypeStat.
What IP addresses does Sreenarasimhaswamykshethrampala.net resolve to?
• Sreenarasimhaswamykshethrampala.net resolves to the IP addresses 192.185.129.121.
Where are Sreenarasimhaswamykshethrampala.net servers located in?
• Sreenarasimhaswamykshethrampala.net has servers located in Houston, Texas, 77092, United States.
sreenarasimhaswamykshethrampala.net Profile
Title:ശ്രീ നരസിംഹ സ്വാമി ക്ഷേത്രം
What technologies does sreenarasimhaswamykshethrampala.net use?
These are the technologies used at sreenarasimhaswamykshethrampala.net. sreenarasimhaswamykshethrampala.net has a total of 4 technologies installed in 4 different categories.sreenarasimhaswamykshethrampala.net Traffic Analysis
Sreenarasimhaswamykshethrampala.net is ranked #7,574,623 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 7,574,623
Last update was 1606 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with sreenarasimhaswamykshethrampala.net in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- sreenarasimhaswamykshethrampala.net
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- sreenarasimhaswamykshethrampala.net
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- sreenarasimhaswamykshethrampala.net
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- sreenarasimhaswamykshethrampala.net
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is sreenarasimhaswamykshethrampala.net hosted? ▼
Sreenarasimhaswamykshethrampala.net may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 192.185.129.121
- ASN:
- AS46606
- ISP:
- Unified Layer
- Server Location:
- Houston
Texas, TX
77092
United States, US
Other sites hosted on 192.185.129.121
Does sreenarasimhaswamykshethrampala.net use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on sreenarasimhaswamykshethrampala.net are reduced by 69%.
sreenarasimhaswamykshethrampala.net use gzip compression.
Original size: 29.75 KB
Compressed size: 9 KB
File reduced by: 20.75 KB (69%)
Compressed size: 9 KB
File reduced by: 20.75 KB (69%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. sreenarasimhaswamykshethrampala.net does not support HTTPS. sreenarasimhaswamykshethrampala.net does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. sreenarasimhaswamykshethrampala.net does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Upgrade: h2c
Connection: Upgrade
HTTP/2 200
date: Thu, 01 Jan 1970 00:00:00 GMT
server: Apache
content-type: text/html; charset=UTF-8
Connection: Keep-Alive
Content-Type: text/html
Last-Modified: Sun, 27 Jan 2013 05:39:02 GMT
Accept-Ranges: bytes
Content-Encoding: br
Vary: Accept-Encoding,User-Agent
Content-Length: 411
Date: Mon, 24 Feb 2020 00:40:02 GMT
Server: LiteSpeed
Server: nginx
Date: Mon, 24 Feb 2020 00:40:07 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 60
Connection: keep-alive
Location: http://www.ultimaterevenuestream.com/
X-Served-By: Namecheap URL Forward
HTTP/1.1 200 OK
Date: Mon, 24 Feb 2020 00:40:07 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Cache-Control: no-cache
Pragma: no-cache
Expires: -1
X-CST: MISS
Server: namecheap-nginx
X-CST: MISS
Allow: GET, HEAD
Content-Encoding: gzip
Upgrade: h2c
Connection: Upgrade
HTTP/2 200
date: Thu, 01 Jan 1970 00:00:00 GMT
server: Apache
last-modified: Wed, 04 Sep 2019 12:15:01 GMT
etag: W/"ec1331-6e3-591b92782f631-gzip"
accept-ranges: bytes
vary: Accept-Encoding,User-Agent
content-encoding: gzip
content-length: 719
content-type: text/html
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Mon, 24 Feb 2020 00:40:25 GMT
Content-Length: 68308
Date: Mon, 24 Feb 2020 00:40:46 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d84eef3069c8962b57ef3dfb00a811f051582504842; expires=Wed, 25-Mar-20 00:40:42 GMT; path=/; domain=.pressurewashingtownncountry.com; HttpOnly; SameSite=Lax
X-Powered-By: PHP/7.2.27
X-Redirect-By: WordPress
Location: https://www.pressurewashingtownncountry.com/
Cache-Control: public, max-age=3600
Expires: Mon, 24 Feb 2020 01:40:46 GMT
Strict-Transport-Security: max-age=63072000; includeSubDomains
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
Referrer-Policy: no-referrer-when-downgrade
X-Turbo-Charged-By: LiteSpeed
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 569d63c3c9d54235-MSP
HTTP/2 200
date: Mon, 24 Feb 2020 00:40:48 GMT
content-type: text/html; charset=UTF-8
set-cookie: __cfduid=da95667848bd4706ec81720000d550c841582504846; expires=Wed, 25-Mar-20 00:40:46 GMT; path=/; domain=.pressurewashingtownncountry.com; HttpOnly; SameSite=Lax
link: <https://www.pressurewashingtownncountry.com/wp-json/>; rel="https://api.w.org/"
link: <https://www.pressurewashingtownncountry.com/>; rel=shortlink
last-modified: Mon, 24 Feb 2020 00:40:48 GMT
expires: Mon, 24 Feb 2020 01:40:48 GMT
pragma: public
cache-control: max-age=3600, public
x-powered-by: W3 Total Cache/0.9.7.5
vary: Accept-Encoding
strict-transport-security: max-age=63072000; includeSubDomains
x-frame-options: SAMEORIGIN
x-content-type-options: nosniff
referrer-policy: no-referrer-when-downgrade
x-turbo-charged-by: LiteSpeed
cf-cache-status: DYNAMIC
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
server: cloudflare
cf-ray: 569d63dc2d92c64f-MSP
content-encoding: br
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=15
Date: Mon, 24 Feb 2020 00:40:50 GMT
Server: Apache
Last-Modified: Sat, 11 May 2019 09:11:14 GMT
ETag: W/"e5-5889910a90e3d"
Content-Encoding: gzip
Date: Mon, 24 Feb 2020 00:40:51 GMT
Server: Apache/2.4.6 (CentOS) PHP/5.4.16
X-Powered-By: PHP/5.4.16
Content-Length: 2153
Connection: close
Content-Type: text/html; charset=UTF-8
Date: Mon, 24 Feb 2020 00:40:52 GMT
Server: Apache/2.4.41 (Unix)
Content-Length: 4508
Content-Type: text/html
Server: nginx
Date: Mon, 24 Feb 2020 00:40:54 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Content-Encoding: gzip
Server: nginx/1.14.1
Date: Mon, 24 Feb 2020 00:40:57 GMT
Content-Type: text/html
Content-Length: 0
Connection: keep-alive
Last-Modified: Tue, 14 May 2019 16:50:43 GMT
Accept-Ranges: bytes
Date: Mon, 24 Feb 2020 00:40:57 GMT
Content-Length: 0
Connection: keep-alive
expires: -1
location: https://www.malhadadance.com/
x-seen-by: gv/XVF9HsGpk8A2KWukUzOwfbs+7qUVAqsIx00yI78k=,BTzakfJUbU/4CBguyutVd1BmDjYppDd6MXvikk+MVGE=,1wy2ILu/S4rlWT/R4rqCrak2rkv0vJrEwG04nSYjamo=,qJS91GsscGZlb16v+8nwmGObu0zMeP4cpDUisSGZx6FGp/J3MBzgzU8QHrQuh4zQ,nxVDKlf5lZ8xGkFSmm2J1sBAWn6tWs3xKPTP+JSXnhh9FkMEnd2lmjdBywX4tuYowjmskH3shEbt4DpRNU2mpw==
cache-control: no-cache
content-language: en
X-Wix-Request-Id: 1582504857.80424280173349132444
HTTP/1.1 200 OK
Date: Mon, 24 Feb 2020 00:40:58 GMT
Content-Type: text/html;charset=utf-8
Connection: keep-alive
Content-Language: en
Pragma: no-cache
Link: <https://static.parastorage.com/>; rel=preconnect; crossorigin,<https://fonts.gstatic.com>; rel=preconnect; crossorigin,<https://static.wixstatic.com/>; rel=preconnect;,<https://static.parastorage.com/unpkg/requirejs-bolt@2.3.6/requirejs.min.js>; rel=preload; as=script;,<https://static.parastorage.com/unpkg/lodash@4.17.15/lodash.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.parastorage.com/unpkg/zepto@1.2.0/dist/zepto.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.wixstatic.com/>; rel=preconnect; crossorigin;,<https://static.parastorage.com/services/wix-bolt/1.5052.0/bolt-main/app/main-r.min.js>; rel=preload; as=script ; crossorigin=anonymous;
Age: 1621
Set-Cookie: ssr-caching="cache,desc=hit,varnish=hit, dc,desc=96";Version=1;Expires=Mon, 24-Feb-2020 00:14:16 GMT;Max-Age=20
Server-Timing: cache;desc=hit, varnish;desc=hit, dc;desc=96
Cache-Control: no-cache, no-store, no-cache
Expires: Thu, 01 Jan 1970 00:00:00 GMT
X-Seen-By: jeslxIFvDH4ulYwNNi+3MiWfEJXUOf1J0Ah0dFlolkk=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVhAxKiWYUWCOytbZ2IYI/x7,2d58ifebGbosy5xc+FRaloPX4ngKfQM8fEHbwELHijnCi2PKl2FzLrvgTVMhh0n/,Nlv1KFVtIvAfa3AK9dRsIxztGaGoMyi7WcjTPsGnKyRYgeUJqUXtid+86vZww+nL,2UNV7KOq4oGjA5+PKsX47CEDjWNvUm98mveTHVaM9ww=
X-Wix-Request-Id: 1582504858.238108014873122717
set-cookie: hs=1340036735; Path=/; Domain=www.malhadadance.com; HTTPOnly
set-cookie: svSession=461500279aed034b571a55e86a6455bcd056750dd17e92c2457c522b782527bbee86c6c2f5e6395d58610c258051abb21e60994d53964e647acf431e4f798bcd40793578d921b10d6b3afc1026d8a783984bb6249dab914ee6a2db73fc180b82; Max-Age=63158399; Expires=Thu, 24 Feb 2022 00:40:57 GMT; Path=/; Domain=www.malhadadance.com
set-cookie: XSRF-TOKEN=1582504858|Qy1XKVAqwqGk; Path=/; Domain=www.malhadadance.com
Content-Encoding: gzip
Set-Cookie: TS01e85bed=01b84e286a7306da4e79610266eff2dea02a20b1fec04ce2af47770e75688b6c8bebda1d63e902a545f30d5305ed6b83061d3649ecc945144c20acda8250719ff8e6bc073a; Path=/
Set-Cookie: TS017fc87c=01b84e286aa02a01e90c1172d4c108bf749997f95cc04ce2af47770e75688b6c8bebda1d6350403c6f97f4fd0e8c52c491cd7f4ccf59559a85d765c029416d8b4735eaed22d73a82e6f0a36f967dc00ca478f2e521622a9af9babe6d5940f22735e1cbfd08; path=/; domain=www.malhadadance.com
Transfer-Encoding: chunked
Date: Mon, 24 Feb 2020 00:41:12 GMT
Server: Apache
Content-Length: 315
Connection: close
Content-Type: text/html; charset=iso-8859-1
Date: Mon, 24 Feb 2020 00:41:14 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d9db96bda5ba5c33bf1d4955e245963651582504874; expires=Wed, 25-Mar-20 00:41:14 GMT; path=/; domain=.happybirthdaywishes24.com; HttpOnly; SameSite=Lax
X-Redirect-By: WordPress
Location: https://happybirthdaywishes24.com/
Cache-Control: max-age=0
Expires: Mon, 24 Feb 2020 00:41:14 GMT
Vary: Accept-Encoding
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 569d64886abb4217-MSP
HTTP/2 200
date: Mon, 24 Feb 2020 00:41:14 GMT
content-type: text/html; charset=UTF-8
set-cookie: __cfduid=d1a18ce90ab28665d8bd57867d5be13e91582504874; expires=Wed, 25-Mar-20 00:41:14 GMT; path=/; domain=.happybirthdaywishes24.com; HttpOnly; SameSite=Lax
last-modified: Sun, 23 Feb 2020 21:23:21 GMT
cache-control: max-age=0
expires: Mon, 24 Feb 2020 00:41:14 GMT
vary: Accept-Encoding
cf-cache-status: DYNAMIC
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
server: cloudflare
cf-ray: 569d648bdbeec64f-MSP
content-encoding: br
Upgrade: h2c
Connection: Upgrade
HTTP/2 200
date: Thu, 01 Jan 1970 00:00:00 GMT
server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
last-modified: Thu, 07 Nov 2019 06:14:50 GMT
accept-ranges: none
vary: Accept-Encoding
content-encoding: gzip
content-length: 9217
content-type: text/html
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 3600 | ||
Mname | ns1.md-ht-5.bigrockservers.com | ||
Rname | cpanel.webhostbox.net | ||
Serial Number | 2019051405 | ||
Refresh | 86400 | ||
Retry | 7200 | ||
Expire | 3600000 | ||
Minimum TTL | 86400 | ||
MX | 3600 | ||
A | 192.185.129.121 | 3599 | |
NS | 3599 | ||
NS | 3599 |