Kellerwilliamsrealtyfranklin.com
Msfreightbrokerage.com
Domain Summary
What is the traffic rank for Kellerwilliamsrealtyfranklin.com?
• Kellerwilliamsrealtyfranklin.com ranks #12,627,635 globally on HypeStat.
Where are Kellerwilliamsrealtyfranklin.com servers located in?
• Kellerwilliamsrealtyfranklin.com has servers located in Jacksonville, Florida, 32258, United States.
kellerwilliamsrealtyfranklin.com Profile
Title:Msfreightbrokerage.com
What technologies does kellerwilliamsrealtyfranklin.com use?
These are the technologies used at kellerwilliamsrealtyfranklin.com. kellerwilliamsrealtyfranklin.com has a total of 5 technologies installed in 4 different categories.kellerwilliamsrealtyfranklin.com Traffic Analysis
Kellerwilliamsrealtyfranklin.com is ranked #12,627,635 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 12,627,635
Last update was 2403 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with kellerwilliamsrealtyfranklin.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- kellerwilliamsrealtyfranklin.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- kellerwilliamsrealtyfranklin.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- kellerwilliamsrealtyfranklin.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- kellerwilliamsrealtyfranklin.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is kellerwilliamsrealtyfranklin.com hosted? ▼
Kellerwilliamsrealtyfranklin.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- n/a
- ASN:
- AS55002
- ISP:
- Defense.Net, Inc
- Server Location:
- Jacksonville
Florida, FL
32258
United States, US
Other sites hosted on n/a
There are no other sites hosted on this IPDoes kellerwilliamsrealtyfranklin.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on kellerwilliamsrealtyfranklin.com are reduced by 82%.
kellerwilliamsrealtyfranklin.com use gzip compression.
Original size: 50.97 KB
Compressed size: 8.92 KB
File reduced by: 42.06 KB (82%)
Compressed size: 8.92 KB
File reduced by: 42.06 KB (82%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. kellerwilliamsrealtyfranklin.com does not support HTTPS. kellerwilliamsrealtyfranklin.com does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. kellerwilliamsrealtyfranklin.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Date: Mon, 03 Jun 2019 09:04:02 GMT
Server: Apache
Vary: Accept-Encoding,Cookie
X-Redirect-By: WordPress
Location: http://www.bigstreammedia.com/
Content-Encoding: gzip
Content-Length: 20
Content-Type: text/html; charset=UTF-8
HTTP/1.1 200 OK
Date: Mon, 03 Jun 2019 09:04:05 GMT
Server: Apache
Vary: Accept-Encoding,Cookie
Link: <https://www.bigstreammedia.com/wp-json/>; rel="https://api.w.org/"
Content-Encoding: gzip
Content-Length: 5273
Content-Type: text/html; charset=UTF-8
Server: nginx/1.12.2
Date: Mon, 03 Jun 2019 09:04:10 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: close
Location: http://www.laurahazan.com
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Mon, 03 Jun 2019 09:04:10 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://www.laurahazan.com/
X-ac: 3.ord _dca
HTTP/2 301
server: nginx
date: Mon, 03 Jun 2019 09:04:11 GMT
content-type: text/html
content-length: 162
location: https://laurahazan.com/
strict-transport-security: max-age=86400
x-ac: 3.ord _dca
HTTP/2 200
server: nginx
date: Mon, 03 Jun 2019 09:04:11 GMT
content-type: text/html; charset=UTF-8
strict-transport-security: max-age=86400
vary: Accept-Encoding
vary: Cookie
x-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
link: <https://wp.me/P48xlH-41>; rel=shortlink
content-encoding: gzip
x-ac: 3.ord _dca
Server: nginx/1.10.3
Date: Mon, 03 Jun 2019 17:06:00 GMT
Content-Type: text/html
Content-Length: 185
Connection: keep-alive
Location: http://www.thai-beautybuffet.com/
HTTP/1.1 200 OK
Server: nginx/1.10.3
Date: Mon, 03 Jun 2019 17:06:01 GMT
Content-Type: text/html
Last-Modified: Wed, 06 Mar 2019 03:47:30 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
ETag: W/"5c7f42d2-daa4"
Content-Encoding: gzip
Date: Mon, 03 Jun 2019 09:04:28 GMT
Server: nginx/1.15.10
Content-Type: text/html; charset=UTF-8
Content-Length: 0
X-Redirect-By: WordPress
Expires: Wed, 11 Jan 1984 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, max-age=0
Location: https://alwaysnazzy.com/
X-Endurance-Cache-Level: 2
X-Server-Cache: true
X-Proxy-Cache: MISS
Set-Cookie: br_lgv_stat=grid%7Cdefault; path=/; domain=alwaysnazzy.com
HTTP/2 200
date: Mon, 03 Jun 2019 09:04:30 GMT
server: nginx/1.15.10
content-type: text/html; charset=UTF-8
content-length: 9182
link: <https://alwaysnazzy.com/wp-json/>; rel="https://api.w.org/"
cache-control: max-age=600
expires: Mon, 03 Jun 2019 09:14:29 GMT
vary: Accept-Encoding
content-encoding: gzip
x-endurance-cache-level: 2
x-server-cache: true
x-proxy-cache: MISS
set-cookie: br_lgv_stat=grid%7Cdefault; path=/; domain=alwaysnazzy.com
Server: nginx
Date: Mon, 03 Jun 2019 09:04:33 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Location: https://hillwell.tokyo/
HTTP/2 200
server: nginx
date: Mon, 03 Jun 2019 09:04:34 GMT
content-type: text/html; charset=UTF-8
last-modified: Tue, 28 May 2019 06:08:12 GMT
etag: W/"101c-589ec7d5bab00"
x-xss-protection: 1; mode=block
x-content-type-options: nosniff
content-encoding: gzip
Date: Mon, 03 Jun 2019 09:04:36 GMT
Content-Type: text/html
Content-Length: 1183
Connection: keep-alive
Keep-Alive: timeout=30
Server: Apache/2
Last-Modified: Thu, 28 Feb 2019 20:38:08 GMT
ETag: "49f-582fa44a33c84"
Cache-Control: max-age=3600
Expires: Mon, 03 Jun 2019 10:04:36 GMT
Accept-Ranges: bytes
Age: 0
Content-Type: text/html; charset=utf-8
x-ua-compatible: IE=edge
Cache-Control: no-cache, no-store, max-age=0, must-revalidate
Pragma: no-cache
Expires: Mon, 01 Jan 1990 00:00:00 GMT
Date: Mon, 03 Jun 2019 09:04:37 GMT
P3P: CP="This is not a P3P policy! See g.co/p3phelp for more info."
Content-Security-Policy: script-src 'report-sample' 'nonce-PzwiKtWP6WyK0wDa4pB81w' 'unsafe-inline';object-src 'none';base-uri 'self';report-uri /_/GeoMerchantPrestoSiteUi/cspreport;worker-src 'self'
Content-Encoding: gzip
Transfer-Encoding: chunked
Server: ESF
X-XSS-Protection: 0
X-Content-Type-Options: nosniff
Set-Cookie: NID=184=ZvxEvLnX0EZMvZRw6Pt9-YMvX8U2jcvSh6Xu33kUbvUDWEl1tzm7dSHN9uoYeqAThpCtJQH67gvcQt8dQ-Q53j49oKFL4SsLCyP-R14zkGnF2Q6VtgLfDL7Fjz0s3xMu3IugQzvPzGLw_9ok82tgKjYhNGA901GuRxM0T8OTlWo;Domain=.google.com;Path=/;Expires=Tue, 03-Dec-2019 09:04:37 GMT;HttpOnly
Server: nginx/1.10.1
Date: Mon, 03 Jun 2019 09:04:48 GMT
Content-Type: text/html
Content-Length: 185
Connection: keep-alive
Location: https://leon6561.com/
HTTP/1.1 301 Moved Permanently
Server: nginx/1.10.1
Date: Mon, 03 Jun 2019 09:04:49 GMT
Content-Type: text/html
Content-Length: 185
Connection: keep-alive
Location: https://ru.leon6561.com/
HTTP/1.1 200 OK
Server: nginx/1.10.1
Date: Mon, 03 Jun 2019 09:04:49 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
X-DIS-Request-ID: d8643d46a51a0242fd9ca295417c7de7
P3P: CP="NON DSP COR ADMa OUR IND UNI COM NAV INT"
Cache-Control: no-cache
Date: Mon, 03 Jun 2019 09:04:52 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=dd2751fa6a2efb8954dea7834004c3ad71559552692; expires=Tue, 02-Jun-20 09:04:52 GMT; path=/; domain=.brokentoaster.info; HttpOnly
X-Powered-By: PHP/5.3.3
Link: <http://brokentoaster.info/wp-json/>; rel="https://api.w.org/"
Server: cloudflare
CF-RAY: 4e1080855843c62f-MSP
Content-Encoding: gzip
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /fLaNU/
HTTP/1.1 302 Found
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /
HTTP/1.1 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Mon, 03 Jun 2019 09:04:52 GMT
Content-Length: 458
Age: 4
Connection: keep-alive
Server: openresty/1.13.6.2
Date: Mon, 03 Jun 2019 09:04:57 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Powered-By: PHP/5.6.17-pl0-gentoo
X-Webcom-Cache-Status: BYPASS
Content-Encoding: gzip
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| SOA | 3600 | ||
| Mname | ns43.domaincontrol.com | ||
| Rname | dns.jomax.net | ||
| Serial Number | 2019052105 | ||
| Refresh | 28800 | ||
| Retry | 7200 | ||
| Expire | 604800 | ||
| Minimum TTL | 600 | ||
| NS | 3600 | ||
| NS | 3600 |