kayserisempatikveterinerklinigi.com Kayserisempatikveterinerklinigi.com

   
Kayserisempatikveterinerklinigi.com YAKINDA...

Domain Summary

What is the traffic rank for Kayserisempatikveterinerklinigi.com?

• Kayserisempatikveterinerklinigi.com ranks #14,904,249 globally on HypeStat.

What IP addresses does Kayserisempatikveterinerklinigi.com resolve to?

• Kayserisempatikveterinerklinigi.com resolves to the IP addresses 209.141.38.71.

Where are Kayserisempatikveterinerklinigi.com servers located in?

• Kayserisempatikveterinerklinigi.com has servers located in Las Vegas, Nevada, 89101, United States.

kayserisempatikveterinerklinigi.com Profile

Title:kayserisempatikveterinerklinigi.com YAKINDA... Description:kayserisempatikveterinerklinigi.com YAKINDA...

What technologies does kayserisempatikveterinerklinigi.com use?

These are the technologies used at kayserisempatikveterinerklinigi.com. kayserisempatikveterinerklinigi.com has a total of 4 technologies installed in 4 different categories.

kayserisempatikveterinerklinigi.com Traffic Analysis

Kayserisempatikveterinerklinigi.com is ranked #14,904,249 in the world.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
14,904,249
*All traffic values are estimates only.
Last update was 2275 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with kayserisempatikveterinerklinigi.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  kayserisempatikveterinerklinigi.com
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
kayserisempatikveterinerklinigi.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
kayserisempatikveterinerklinigi.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
kayserisempatikveterinerklinigi.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is kayserisempatikveterinerklinigi.com hosted?

Kayserisempatikveterinerklinigi.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
209.141.38.71
ASN:
AS53667 
ISP:
FranTech Solutions 
Server Location:
Las Vegas
Nevada, NV
89101
United States, US
 

Other sites hosted on 209.141.38.71

Does kayserisempatikveterinerklinigi.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on kayserisempatikveterinerklinigi.com are reduced by 65%.
kayserisempatikveterinerklinigi.com use gzip compression.
Original size: 4.95 KB
Compressed size: 1.73 KB
File reduced by: 3.22 KB (65%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. kayserisempatikveterinerklinigi.com does not support HTTPS.
 kayserisempatikveterinerklinigi.com does not support HTTPS
     
Verifying SSL Support. Please wait...

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 kayserisempatikveterinerklinigi.com does not support HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
Date: Sun, 21 Jul 2019 14:23:02 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=db17c7d0234fac6239af5aa91bef0ef951563718982; expires=Mon, 20-Jul-20 14:23:02 GMT; path=/; domain=.rocketspain.com; HttpOnly
X-Sorting-Hat-PodId: 65
X-Sorting-Hat-ShopId: 7921467458
X-Frame-Options: DENY
X-ShopId: 7921467458
X-ShardId: 65
Content-Language: es
Location: https://www.rocketspain.com/
X-Shopify-Stage: production
Content-Security-Policy: frame-ancestors 'none'; report-uri /csp-report?source%5Baction%5D=index&source%5Bapp%5D=Shopify&source%5Bcontroller%5D=storefront_section%2Fshop&source%5Bsection%5D=storefront&source%5Buuid%5D=f3896b24-480f-4576-966d-efd1051c5342
X-Content-Type-Options: nosniff
X-Download-Options: noopen
X-Permitted-Cross-Domain-Policies: none
X-XSS-Protection: 1; mode=block; report=/xss-report?source%5Baction%5D=index&source%5Bapp%5D=Shopify&source%5Bcontroller%5D=storefront_section%2Fshop&source%5Bsection%5D=storefront&source%5Buuid%5D=f3896b24-480f-4576-966d-efd1051c5342
X-Dc: gcp-us-east1,gcp-us-central1,gcp-us-central1
NEL: {"report_to":"network-errors","max_age":2592000,"failure_fraction":0.01,"success_fraction":0.0001}
Report-To: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifycloud.com/v1/reports/nel/20190325/shopify"}]}
X-Request-ID: f3896b24-480f-4576-966d-efd1051c5342
NEL: {"report_to":"network-errors","max_age":2592000,"failure_fraction":0.01,"success_fraction":0.0001}
Report-To: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifycloud.com/v1/reports/nel/20190325/shopify"}]}
Server: cloudflare
CF-RAY: 4f9dd499f99fc647-MSP

HTTP/2 302 
date: Sun, 21 Jul 2019 14:23:03 GMT
content-type: text/html; charset=utf-8
set-cookie: __cfduid=d0ab838603cbb644308d73cb4c53f05f51563718983; expires=Mon, 20-Jul-20 14:23:03 GMT; path=/; domain=.www.rocketspain.com; HttpOnly
x-sorting-hat-podid: 65
x-sorting-hat-shopid: 7921467458
x-frame-options: DENY
x-shopid: 7921467458
x-shardid: 65
content-language: es
x-cache: allow
location: https://www.rocketspain.com/password
strict-transport-security: max-age=7889238
set-cookie: _shopify_y=9f9041cb-5a32-42b9-84e3-ec906642240e; path=/; expires=Wed, 21 Jul 2021 02:01:27 -0000
x-request-id: b2634a10-73af-4876-8749-3f2055a743b2
x-shopify-stage: production
content-security-policy: block-all-mixed-content; frame-ancestors 'none'; upgrade-insecure-requests; report-uri /csp-report?source%5Baction%5D=index&source%5Bapp%5D=Shopify&source%5Bcontroller%5D=storefront_section%2Fshop&source%5Bsection%5D=storefront&source%5Buuid%5D=b2634a10-73af-4876-8749-3f2055a743b2
x-content-type-options: nosniff
x-download-options: noopen
x-permitted-cross-domain-policies: none
x-xss-protection: 1; mode=block; report=/xss-report?source%5Baction%5D=index&source%5Bapp%5D=Shopify&source%5Bcontroller%5D=storefront_section%2Fshop&source%5Bsection%5D=storefront&source%5Buuid%5D=b2634a10-73af-4876-8749-3f2055a743b2
x-dc: gcp-us-central1,gcp-us-central1
nel: {"report_to":"network-errors","max_age":2592000,"failure_fraction":0.01,"success_fraction":0.0001}
report-to: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifycloud.com/v1/reports/nel/20190325/shopify"}]}
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
server: cloudflare
cf-ray: 4f9dd49e0cbd4223-MSP

HTTP/2 200 
date: Sun, 21 Jul 2019 14:23:03 GMT
content-type: text/html; charset=utf-8
set-cookie: __cfduid=d0ab838603cbb644308d73cb4c53f05f51563718983; expires=Mon, 20-Jul-20 14:23:03 GMT; path=/; domain=.www.rocketspain.com; HttpOnly
x-sorting-hat-podid: 65
x-sorting-hat-shopid: 7921467458
x-frame-options: DENY
x-shopid: 7921467458
x-shardid: 65
content-language: es
content-encoding: gzip
x-robots-tag: nofollow
strict-transport-security: max-age=7889238
etag: cacheable:0e483cb46c8b07b86f41d8e51fb7322d
x-alternate-cache-key: cacheable:47a5d7c58924a20fee7a4949a20dd791
x-cache: hit, server
set-cookie: _shopify_y=88c539f8-d7d5-4c5f-a227-bd9ac4160ab6; path=/; expires=Wed, 21 Jul 2021 02:01:27 -0000
x-request-id: 9579a32b-3065-4ca1-8a2d-131e8568afb1
x-shopify-stage: production
content-security-policy: block-all-mixed-content; frame-ancestors 'none'; upgrade-insecure-requests; report-uri /csp-report?source%5Baction%5D=password&source%5Bapp%5D=Shopify&source%5Bcontroller%5D=storefront_section%2Fstorefront&source%5Bsection%5D=storefront&source%5Buuid%5D=9579a32b-3065-4ca1-8a2d-131e8568afb1
x-content-type-options: nosniff
x-download-options: noopen
x-permitted-cross-domain-policies: none
x-xss-protection: 1; mode=block; report=/xss-report?source%5Baction%5D=password&source%5Bapp%5D=Shopify&source%5Bcontroller%5D=storefront_section%2Fstorefront&source%5Bsection%5D=storefront&source%5Buuid%5D=9579a32b-3065-4ca1-8a2d-131e8568afb1
x-dc: gcp-us-central1,gcp-us-central1
set-cookie: _orig_referrer=https%3A%2F%2Fhypestat.com; Expires=Sun, 04-Aug-19 14:23:03 GMT; Path=/; HttpOnly
set-cookie: secure_customer_sig=; path=/; expires=Thu, 21 Jul 2039 14:23:03 -0000; secure; HttpOnly
set-cookie: _landing_page=%2Fpassword; Expires=Sun, 04-Aug-19 14:23:03 GMT; Path=/; HttpOnly
set-cookie: cart_sig=; path=/; expires=Sun, 04 Aug 2019 14:23:03 -0000; HttpOnly
nel: {"report_to":"network-errors","max_age":2592000,"failure_fraction":0.01,"success_fraction":0.0001}
report-to: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifycloud.com/v1/reports/nel/20190325/shopify"}]}
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
server: cloudflare
cf-ray: 4f9dd49e9ce64223-MSP
Server: nginx
Date: Sun, 21 Jul 2019 14:23:07 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Location: http://www.kayserisempatikveterinerklinigi.com/

HTTP/1.1 200 OK
Server: nginx
Date: Sun, 21 Jul 2019 14:23:07 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip
X-Proxy-Cache: MISS

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
A 192.161.187.200 3600
A 209.141.38.71 3600
A 107.161.23.204 3600
SOA 3600
Mname ns1.dnsowl.com
Rname hostmaster.dnsowl.com
Serial Number 1563718735
Refresh 7200
Retry 1800
Expire 1209600
Minimum TTL 600
NS ns2.dnsowl.com 3597
NS ns3.dnsowl.com 3597
NS ns1.dnsowl.com 3597