Davnosti.press
HOME | #davnosti | Well outdated news | Independent Media Channel
Domain Summary
What is the traffic rank for Davnosti.press?
• Davnosti.press ranks #14,859,091 globally on HypeStat.
What IP addresses does Davnosti.press resolve to?
• Davnosti.press resolves to the IP addresses 194.58.112.173.
Where are Davnosti.press servers located in?
• Davnosti.press has servers located in Russia.
davnosti.press Profile
Title:HOME | #davnosti | Well outdated news | Independent Media Channel
Description:#davnosti is an independent media that creates meaningful content explaining the past to change the attitude of people to the present and future. www.davnosti.com #davnosti #welloutdatednews #mediachannel #newschannel #independentmedia
#raevskayarepninaannamariaserafima #ÑаевÑкаÑÑепнинааннамаÑиÑÑеÑаÑима #bleksheep
Tags:
What technologies does davnosti.press use?
These are the technologies used at davnosti.press. davnosti.press has a total of 6 technologies installed in 4 different categories.davnosti.press Traffic Analysis
Davnosti.press is ranked #14,859,091 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 14,859,091
Last update was 600 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with davnosti.press in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- davnosti.press
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- davnosti.press
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- davnosti.press
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- davnosti.press
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is davnosti.press hosted? ▼
Davnosti.press may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 194.58.112.173
- ASN:
- AS197695
- ISP:
- Domain names registrar REG.RU, Ltd
- Server Location:
Russia, RU
Other sites hosted on 194.58.112.173
Does davnosti.press use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on davnosti.press are reduced by 76%.
davnosti.press use gzip compression.
Original size: 674.2 KB
Compressed size: 159.17 KB
File reduced by: 515.02 KB (76%)
Compressed size: 159.17 KB
File reduced by: 515.02 KB (76%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. davnosti.press supports HTTPS. davnosti.press supports HTTPS
Verifying SSL Support. Please wait...
Common Name: *.wixsite.com
Organization:
Location:
Issuer: R3
Valid from: Nov 2 12:15:28 2022 GMT
Valid until: Jan 31 12:15:27 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R3
Valid from: Nov 2 12:15:28 2022 GMT
Valid until: Jan 31 12:15:27 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: *.wixsite.com
Organization:
Location:
Issuer: R3
Valid from: Nov 2 12:15:28 2022 GMT
Valid until: Jan 31 12:15:27 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R3
Valid from: Nov 2 12:15:28 2022 GMT
Valid until: Jan 31 12:15:27 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R3
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: ISRG Root X1
Organization: Internet Security Research Group
Location: US
Issuer: ISRG Root X1
Valid from: Jun 4 11:04:38 2015 GMT
Valid until: Jun 4 11:04:38 2035 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Internet Security Research Group
Location: US
Issuer: ISRG Root X1
Valid from: Jun 4 11:04:38 2015 GMT
Valid until: Jun 4 11:04:38 2035 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. davnosti.press supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Server: nginx
Date: Thu, 03 Nov 2022 13:00:02 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 322
Connection: close
Location: https://rareearthgroup.wixsite.com/davnosti
Expires: Thu, 03 Nov 2022 13:05:02 GMT
Cache-Control: max-age=300
HTTP/2 200
date: Thu, 03 Nov 2022 13:00:05 GMT
content-type: text/html; charset=UTF-8
link: <https://static.parastorage.com/>; rel=preconnect; crossorigin;,<https://static.parastorage.com/>; rel=preconnect;,<https://static.wixstatic.com/>; rel=preconnect; crossorigin;,<https://static.wixstatic.com/>; rel=preconnect;,<https://siteassets.parastorage.com>; rel=preconnect; crossorigin;,
x-wix-request-id: 1667480402.9574585821122008
server-timing: cache;desc=none
set-cookie: fedops.logger.defaultOverrides=%7B%22paramsOverridesForApp%22%3A%7B%22js-platform-editor-sdk%22%3A%7B%22is_rollout%22%3Atrue%7D%2C%22add-panel-data-classic-editor%22%3A%7B%22is_rollout%22%3Atrue%7D%7D%7D; Max-Age=60000; Expires=Fri, 04 Nov 2022 05:40:05 GMT
set-cookie: hs=-1102954425; Max-Age=-1; Expires=Thu, 03 Nov 2022 13:00:04 GMT; Path=/; Domain=rareearthgroup.wixsite.com; HTTPOnly
set-cookie: svSession=1d1b85b0ebfdc9f075ce41d5168a74acb2c5af3818d7de80f514b9501d4a8c0eafcb9508e60a769fe0f6c169d168b9401e60994d53964e647acf431e4f798bcda528dc84edb7e60985c653f4dc11b09da92ab69903c5017093d0d0af8cde8c6855c8d01e571d00c78c2e7f0ee00999102d90d35bd28b1dd511ead009eb62f1723f204ddeabe1b72eab528450103e0830; Max-Age=63158399; Expires=Sun, 03 Nov 2024 13:00:04 GMT; Path=/davnosti; Domain=rareearthgroup.wixsite.com; Secure; HTTPOnly; SameSite=None
vary: Accept-Encoding
cache-control: no-cache
content-language: en
strict-transport-security: max-age=3600
set-cookie: XSRF-TOKEN=1667480405|CVYEr5PAmhlr; Path=/; Domain=rareearthgroup.wixsite.com; Secure; SameSite=None
x-seen-by: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVgSRAHQXAt+vLGgzQ12Ac/d,qquldgcFrj2n046g4RNSVGQ0JPxE1eGUizDw6GXu/hw=,2d58ifebGbosy5xc+FRaljB+6T7n6jeNmobZj2GOV4th7colZiB7JJzVpFpPHvXySf524lPwTgDbn82fURSkbnq03zhIzkAZjB92tcpekEE=,osV03DUdKaEVOGwoQFgPYonVVCUlnpHr1goraJCz2eM=,GiE5c8Q213kn1NHwElo57C1v+sf4N9pZLQBOjFHD1cksgBhejHbhQr+ZNwveIOZjmuOkfcTSJaUOHlD2KQbqrA==,sQ19iEk473qMiaixh4sATrTusQNsWquVmqGOTMFxiiU=,sQ19iEk473qMiaixh4sATo+uaiblGfVyDPjDsR1J9Ao=,LoUK8/saGAmOxZWtpubo2vHhE0I8hePjeHEKH+8rLTGQJA45oCDTznhlOdUNnW0b3M5t2UZi5yOBbIewJBor7Q==,sQ19iEk473qMiaixh4sATo+uaiblGfVyDPjDsR1J9Ao=,sQ19iEk473qMiaixh4sAThm0c1PiLPgKvYWwbV/tNnU=,Kx8FQg8qZTqABZy3EnRDz4K/WXc5rW8M9Sr8wzJQjuPTptruft3gNxOj5CVJuh/NhzhUnhQWr++iqUiE262B5A==
content-encoding: gzip
x-content-type-options: nosniff
server: Pepyaka/1.19.10
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
A | 194.58.112.173 | 3600 | |
NS | 3600 | ||
NS | 3600 |