Construsoft.es
Tu partner en soluciones BIM | Construsoft
Domain Summary
What is the traffic rank for Construsoft.es?
• Construsoft.es ranks #4,069,906 globally on HypeStat.
What percent of global Internet users visit Construsoft.es?
• 8.1E-6% of global Internet users visit Construsoft.es
How many people visit Construsoft.es each day?
• Construsoft.es receives approximately 400 visitors and 674 page impressions per day.
How much Construsoft.es can earn?
• Construsoft.es should earn about $2.75/day from advertising revenue.
What is Construsoft.es estimated value?
• Estimated value of Construsoft.es is $2,166.17.
What IP addresses does Construsoft.es resolve to?
• Construsoft.es resolves to the IP addresses 93.189.90.163.
Where are Construsoft.es servers located in?
• Construsoft.es has servers located in Barcelona, Barcelona, 08017, Spain.
construsoft.es Profile
Title:Tu partner en soluciones BIM | Construsoft
Description:Aumentamos la productividad del sector de la construcción facilitando el trabajo colaborativo y la digitalización con software BIM, consultoría y formación.
What technologies does construsoft.es use?
These are the technologies used at construsoft.es. construsoft.es has a total of 9 technologies installed in 9 different categories.construsoft.es Traffic Analysis
Construsoft.es is ranked #4,069,906 in the world. This website is viewed by an estimated 400 visitors daily, generating a total of 674 pageviews. This equates to about 12.1K monthly visitors. Construsoft.es traffic has increased by 47.66% compared to last month.Daily Visitors400
14.96%
Monthly Visits12.1K
47.66%
Pages per Visit1.69
54.97%
Visit duration02:46
44.67%
Bounce Rate74.25%
20.33%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 400
- Monthly Visits:
- 12,120
- Pages per Visit:
- 1.69
- Daily Pageviews:
- 674
- Avg. visit duration:
- 02:46
- Bounce rate:
- 74.25%
- Global Reach:
- 8.1E-6%
- Monthly Visits (SEMrush):
- 12,232
- Monthly Unique Visitors (SEMrush):
- 4,534
- HypeRank:
- 4,069,906
- SEMrush Rank:
- 41,613,424
Traffic sources
- Direct:
- 80.22%
- Referral:
- 0%
- Search:
- 11.20%
- Social:
- 8.58%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 100.00%
- Mobile:
- 0%
Backlinks Report ▼
Construsoft.es has a total of 315 backlinks from 93 referring domains and most of them comes from United States.- Total Backlinks:
- 315
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 93
- Referring IPs:
- 55
- Authority Domain Score:
- 20
Backlinks by country
- Country
- Domains
- United States 67
- Spain 4
- Netherlands 2
- Germany 2
- United Kingdom 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 40
- .pw
- 30
- .net
- 5
- .edu
- 0
- .gov
- 0
Last update was 754 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with construsoft.es in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 401
- Bing Index:
- 335
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- construsoft.es
- Rank:
(Rank based on keywords, cost and organic traffic) - 41,613,424
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 20
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $2.8 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $82.5 and annual gross revenue of approximately $1K. Based on these figures, the site's net worth is estimated at around $2.2K.How much would construsoft.es make?
- Daily Revenue:
- $2.75
- Monthly Revenue:
- $82.50
- Yearly Revenue:
- $1,003.75
How much is construsoft.es worth?
- Website Value:
- $2.2K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- construsoft.es
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- construsoft.es
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- construsoft.es
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is construsoft.es hosted? ▼
Construsoft.es may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 93.189.90.163
- ASN:
- AS49635
- ISP:
- Silicontower, S.l.
- Server Location:
- Barcelona
Barcelona, B
08017
Spain, ES
Other sites hosted on 93.189.90.163
There are no other sites hosted on this IPHow fast does construsoft.es load? ▼
The average loading time of construsoft.es is 1878 ms.- Average Load Time:
- 1878 ms
Does construsoft.es use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on construsoft.es are reduced by 85%.
construsoft.es use gzip compression.
Original size: 169.6 KB
Compressed size: 24.58 KB
File reduced by: 145.02 KB (85%)
Compressed size: 24.58 KB
File reduced by: 145.02 KB (85%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. construsoft.es supports HTTPS. construsoft.es supports HTTPS
Verifying SSL Support. Please wait...
Common Name: construsoft.es
Organization:
Location:
Issuer: R3
Valid from: Jun 7 09:48:45 2023 GMT
Valid until: Sep 5 09:48:44 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R3
Valid from: Jun 7 09:48:45 2023 GMT
Valid until: Sep 5 09:48:44 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R3
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: ISRG Root X1
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Internet Security Research Group
Location: US
Issuer: DST Root CA X3
Valid from: Jan 20 19:14:03 2021 GMT
Valid until: Sep 30 18:14:03 2024 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. construsoft.es supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.server: nginx
date: Sun, 02 Jul 2023 17:29:04 GMT
content-type: text/html
content-length: 162
location: https://www.construsoft.es/
HTTP/2 301
server: nginx
date: Sun, 02 Jul 2023 17:29:05 GMT
content-type: text/html; charset=UTF-8
content-length: 362
x-powered-by: PHP/7.1.33
x-drupal-route-normalizer: 1
x-ua-compatible: IE=edge
content-language: es
x-content-type-options: nosniff
x-frame-options: SAMEORIGIN
x-drupal-cache-tags: config:user.role.anonymous http_response node:1
x-drupal-cache-contexts: user.permissions
cache-control: must-revalidate, no-cache, private
expires: -1
vary:
x-generator: Drupal 8 (https://www.drupal.org)
x-drupal-cache: MISS
pragma: no-cache
location: https://www.construsoft.es/es
x-powered-by: PleskLin
HTTP/2 200
server: nginx
date: Sun, 02 Jul 2023 17:29:06 GMT
content-type: text/html; charset=UTF-8
x-powered-by: PHP/7.1.33
cache-control: must-revalidate, no-cache, private
x-drupal-dynamic-cache: UNCACHEABLE
link: <https://www.construsoft.es/es>; rel="shortlink", <https://www.construsoft.es/es>; rel="canonical", <https://www.construsoft.es/en/3d-bim-solutions>; rel="alternate"; hreflang="en", <https://www.construsoft.es/es/3d-bim-solutions>; rel="alternate"; hreflang="es"
x-ua-compatible: IE=edge
content-language: es
x-content-type-options: nosniff
x-frame-options: SAMEORIGIN
x-drupal-cache-tags: block_content:10 block_content:11 block_content:13 block_content:15 block_content:2 block_content:7 block_content:8 block_content:9 block_content_view block_view config:block.block.about config:block.block.actonnewsletter config:block.block.breadcrumbs config:block.block.czechfooter config:block.block.dropdownlanguage config:block.block.footerimage config:block.block.freedemo config:block.block.gavias_enzio_breadcrumbs config:block.block.gavias_enzio_contactinfo config:block.block.gavias_enzio_content config:block.block.gavias_enzio_copyright config:block.block.gavias_enzio_fblikebox config:block.block.gavias_enzio_gaviassliderlayerslidermain config:block.block.gavias_enzio_help config:block.block.gavias_enzio_local_actions config:block.block.gavias_enzio_local_tasks config:block.block.gavias_enzio_mainnavigation config:block.block.gavias_enzio_messages config:block.block.gavias_enzio_searchform config:block.block.gavias_enzio_simplenewssubscription config:block.block.gavias_enzio_sitebranding config:block.block.gavias_enzio_socialscopyright config:block.block.gavias_enzio_topbar config:block.block.gavias_enzio_twitterblock config:block.block.gavias_enzio_webform config:block.block.gaviassliderlayeratconstrusteel config:block.block.gaviassliderlayeratsliderhomepage config:block.block.gaviassliderlayeratteklastructures config:block.block.gaviassliderlayercadmatic config:block.block.gaviassliderlayercloneslidermaintemporary config:block.block.gaviassliderlayerconstrusteel config:block.block.gaviassliderlayercz_home config:block.block.gaviassliderlayerczimplementacebim config:block.block.gaviassliderlayerczmixedreality config:block.block.gaviassliderlayerczteklastructures config:block.block.gaviassliderlayerenhomepagenewsnew config:block.block.gaviassliderlayerenteklastructures config:block.block.gaviassliderlayerescadmatic config:block.block.gaviassliderlayeressliderhomepage config:block.block.gaviassliderlayeresteklastructures config:block.block.gaviassliderlayerhuconstrusteel config:block.block.gaviassliderlayerhusliderhomepage config:block.block.gaviassliderlayerhuteklastructures config:block.block.gaviassliderlayernews config:block.block.gaviassliderlayernews2 config:block.block.gaviassliderlayernl_sliderhome config:block.block.gaviassliderlayernlaannemersbuprojecten config:block.block.gaviassliderlayernlaannemersinfraprojecten config:block.block.gaviassliderlayernlbetonaannemersprojecten config:block.block.gaviassliderlayernledu config:block.block.gaviassliderlayernledustudenten config:block.block.gaviassliderlayernlhoutskeletbouwprojecten config:block.block.gaviassliderlayernlingenieursbureausprojecten config:block.block.gaviassliderlayernlnieuwsdef config:block.block.gaviassliderlayernlnieuwsmediumscreen config:block.block.gaviassliderlayernlnieuwssmallscreen config:block.block.gaviassliderlayernlprefabbetonprojecten config:block.block.gaviassliderlayernlsliderhomepagev2 config:block.block.gaviassliderlayernlstaalbouwprojecten config:block.block.gaviassliderlayernlteklastructuresbimawards config:block.block.gaviassliderlayernltestcswindowprocesstappen config:block.block.gaviassliderlayernltestimonialstekla config:block.block.gaviassliderlayernltestsliderhomepagev2 config:block.block.gaviassliderlayernltrimbleconnectdynamiccontent config:block.block.gaviassliderlayerplcadmatic config:block.block.gaviassliderlayerplhomepagenews config:block.block.gaviassliderlayerplimplementacebim config:block.block.gaviassliderlayerplsliderhomepage config:block.block.gaviassliderlayerplteklastructures config:block.block.gaviassliderlayerpltrimbleconnect config:block.block.gaviassliderlayerroconstrusteel config:block.block.gaviassliderlayerrosliderhomepage config:block.block.gaviassliderlayerroteklastructures config:block.block.gaviassliderlayerstrumis2 config:block.block.gaviassliderlayerteklastructuresnl config:block.block.latest_news_slider config:block.block.mainnavigation config:block.block.menusecond config:block.block.pagetitle config:block.block.socialside config:block.block.webform config:block.block.webform_2 config:block.block.webform_3 config:block.block.webformulier config:block.block.webformulier_2 config:block_list config:color.theme.gavias_enzio config:configurable_language_list config:easy_breadcrumb.settings config:field.storage.node.field_image config:filter.format.full_html config:filter.format.restricted_html config:google_analytics.settings config:search.settings config:system.menu.main config:system.site config:user.role.anonymous config:views.view.banner config:webform.settings config:webform.webform.contact config:webform.webform.contact_page config:webform.webform.en_product_information_with_capt config:webform.webform.nl_antipiraterij config:webform.webform.nl_modelleur_gezocht config:webform.webform.product_information file:2057 file:3655 file:3656 file:3657 file:3659 file:3660 file:540 file:543 file:544 file:545 http_response local_task node:1 node:105 node:106 node:110 node:112 node:113 node:119 node:148 node:149 node:158 node:160 node:168 node:176 node:177 node:182 node:184 node:186 node:188 node:192 node:193 node:195 node:196 node:199 node:200 node:201 node:202 node:203 node:231 node:30 node:302 node:31 node:326 node:34 node:35 node:36 node:375 node:417 node:422 node:507 node:591 node:592 node:593 node:594 node:595 node:720 node:879 node:884 node_list node_view rendered user:0 webform:contact webform:contact_page webform:en_product_information_with_capt webform:nl_antipiraterij webform:nl_modelleur_gezocht webform:product_information
x-drupal-cache-contexts: languages route theme timezone url.path url.query_args:_wrapper_format url.site user.node_grants:view user.permissions user.roles:anonymous user.roles:authenticated
expires: -1
vary: Accept-Encoding
x-generator: Drupal 8 (https://www.drupal.org)
x-drupal-cache: MISS
pragma: no-cache
content-encoding: gzip
x-powered-by: PleskLin
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
TXT | 3531 | ||
TXT | 3531 | ||
TXT | 3531 | ||
MX | 3531 | ||
SOA | 3531 | ||
Mname | christina.neostrada.nl | ||
Rname | hostmaster.dnssrv.nl | ||
Serial Number | 2023050801 | ||
Refresh | 10800 | ||
Retry | 3600 | ||
Expire | 604800 | ||
Minimum TTL | 3600 | ||
A | 93.189.90.163 | 3531 | |
NS | 3530 | ||
NS | 3530 | ||
NS | 3530 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information.- WhoIs:
Conditions of use for the whois service via port 43 for .es domains Access will only be enabled for IP addresses authorised by Red.es. A maximum of one IP address per user/organisation is permitted. Red.es accepts no responsibility whatsoever for the availability of access to WHOIS, which may be suspended at any time and without prior warning at the discretion of the public entity. The service will be limited to the data established by Red.es. The user promises to make use of the service and to carry out any action derived from the aforesaid use in accordance with current applicable regulations, in particular with legislation on “.es†domain names and personal data protection. In particular, the user undertakes not to use the service to carry out abusive or speculative domain name registrations, pursuant to section 5 of the Sixth Additional Provision of Law 34/2002, of 11 July, on Services of the Information Society and Electronic Commerce. Likewise, the User undertakes not to use the service to obtain data, the possession of which may contravene the provisions of Organic Law 15/1999, of 13 December, on Personal Data Protection, and its Regulations, or in Law 34/2002, of 11 July, on Services of the Information Society and Electronic Commerce. Failure to comply with these conditions will result in the immediate withdrawal of the service and any registered domain name which breaches said conditions may be officially cancelled by Red.es. ------------------------------------------------------------------------------------------------------- The IP address used to perform the query is not authorised or has exceeded the established limit for queries.To request access to the service,complete the form located at https://sede.red.gob.es/sede/whois, where you may also consult the service conditions. ------------------------------------------------------------------------------------------------------- More information on each domain may be consulted at www.dominios.es.