Ankaraevdenevenakliyatfirmasi.com
Ankara Evden Eve Nakliyat | Ankara Parça Eşya Taşıma – Ankara En Ucuz NakliyeDomain Summary
What is the traffic rank for Ankaraevdenevenakliyatfirmasi.com?
• Ankaraevdenevenakliyatfirmasi.com ranks #1,857,720 globally on HypeStat.
What percent of global Internet users visit Ankaraevdenevenakliyatfirmasi.com?
• 3.0E-6% of global Internet users visit Ankaraevdenevenakliyatfirmasi.com
How many people visit Ankaraevdenevenakliyatfirmasi.com each day?
• Ankaraevdenevenakliyatfirmasi.com receives approximately 148 visitors and 4,437 page impressions per day.
How much Ankaraevdenevenakliyatfirmasi.com can earn?
• Ankaraevdenevenakliyatfirmasi.com should earn about $18.10/day from advertising revenue.
What is Ankaraevdenevenakliyatfirmasi.com estimated value?
• Estimated value of Ankaraevdenevenakliyatfirmasi.com is $17,796.15.
What IP addresses does Ankaraevdenevenakliyatfirmasi.com resolve to?
• Ankaraevdenevenakliyatfirmasi.com resolves to the IP addresses 213.238.181.88.
Where are Ankaraevdenevenakliyatfirmasi.com servers located in?
• Ankaraevdenevenakliyatfirmasi.com has servers located in Turkey.
ankaraevdenevenakliyatfirmasi.com Profile
Title:Ankara Evden Eve Nakliyat | Ankara Parça Eşya Taşıma – Ankara En Ucuz Nakliye
What technologies does ankaraevdenevenakliyatfirmasi.com use?
These are the technologies used at ankaraevdenevenakliyatfirmasi.com. ankaraevdenevenakliyatfirmasi.com has a total of 10 technologies installed in 10 different categories.ankaraevdenevenakliyatfirmasi.com Traffic Analysis
Ankaraevdenevenakliyatfirmasi.com is ranked #1,857,720 in the world. This website is viewed by an estimated 148 visitors daily, generating a total of 4.4K pageviews. This equates to about 4.5K monthly visitors.Daily Visitors148
Monthly Visits4.5K
Pages per Visit30.00
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 148
- Monthly Visits:
- 4,484
- Pages per Visit:
- 30.00
- Daily Pageviews:
- 4,437
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- 3.0E-6%
- HypeRank:
- 1,857,720
Last update was 1408 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with ankaraevdenevenakliyatfirmasi.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- ankaraevdenevenakliyatfirmasi.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $18.1 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $543 and annual gross revenue of approximately $6.6K. Based on these figures, the site's net worth is estimated at around $17.8K.How much would ankaraevdenevenakliyatfirmasi.com make?
- Daily Revenue:
- $18.10
- Monthly Revenue:
- $543.00
- Yearly Revenue:
- $6,606.50
How much is ankaraevdenevenakliyatfirmasi.com worth?
- Website Value:
- $17.8K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- ankaraevdenevenakliyatfirmasi.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- ankaraevdenevenakliyatfirmasi.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- ankaraevdenevenakliyatfirmasi.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is ankaraevdenevenakliyatfirmasi.com hosted? ▼
Ankaraevdenevenakliyatfirmasi.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 213.238.181.88
- ASN:
- AS51559
- ISP:
- Netinternet Bilisim Teknolojileri AS
- Server Location:
Turkey, TR
Other sites hosted on 213.238.181.88
Does ankaraevdenevenakliyatfirmasi.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on ankaraevdenevenakliyatfirmasi.com are reduced by 82%.
ankaraevdenevenakliyatfirmasi.com use br compression.
Original size: 113.35 KB
Compressed size: 20.04 KB
File reduced by: 93.31 KB (82%)
Compressed size: 20.04 KB
File reduced by: 93.31 KB (82%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. ankaraevdenevenakliyatfirmasi.com supports HTTPS. ankaraevdenevenakliyatfirmasi.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: ankaraevdenevenakliyatfirmasi.com
Organization:
Location:
Issuer: Let's Encrypt Authority X3
Valid from: May 17 03:24:52 2020 GMT
Valid until: Aug 15 03:24:52 2020 GMT
Authority: Is not a CA
Keysize:
Organization:
Location:
Issuer: Let's Encrypt Authority X3
Valid from: May 17 03:24:52 2020 GMT
Valid until: Aug 15 03:24:52 2020 GMT
Authority: Is not a CA
Keysize:
Common Name: Let's Encrypt Authority X3
Organization: Let's Encrypt
Location: US
Issuer: DST Root CA X3
Valid from: Mar 17 16:40:46 2016 GMT
Valid until: Mar 17 16:40:46 2021 GMT
Authority: Is a CA
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: DST Root CA X3
Valid from: Mar 17 16:40:46 2016 GMT
Valid until: Mar 17 16:40:46 2021 GMT
Authority: Is a CA
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. ankaraevdenevenakliyatfirmasi.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Connection: Keep-Alive
Content-Type: text/html; charset=UTF-8
Link: <http://ankaraevdenevenakliyatfirmasi.com/wp-json/>; rel="https://api.w.org/"
Link: <http://ankaraevdenevenakliyatfirmasi.com/>; rel=shortlink
Etag: "724-1591571382;br"
X-LiteSpeed-Cache: hit
Transfer-Encoding: chunked
Content-Encoding: br
Vary: Accept-Encoding,User-Agent
Date: Thu, 11 Jun 2020 12:47:07 GMT
Server: LiteSpeed
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
TXT | 3600 | ||
MX | 3600 | ||
SOA | 3600 | ||
Mname | ns1.odeaweb.com | ||
Rname | noreply.odeaweb.com | ||
Serial Number | 2020051701 | ||
Refresh | 3600 | ||
Retry | 1800 | ||
Expire | 1209600 | ||
Minimum TTL | 86400 | ||
A | 213.238.181.88 | 3600 | |
NS | 3574 | ||
NS | 3574 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on November 23, 2017 and will expire on April 20, 2024 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on April 20, 2024.- Domain Created:
- 2017-11-23
- Domain Age:
- 6 years 4 months 27 days
- WhoIs:
whois lookup at whois.atakteknoloji.com...whois lookup at whois.crsnic.net...Domain Name: ANKARAEVDENEVENAKLIYATFIRMASI.COM Registry Domain ID: 2191199937_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.atakteknoloji.com Registrar URL: http://www.atakdomain.com Updated Date: 2020-03-16T21:25:56Z Creation Date: 2017-11-23T20:36:14Z Registry Expiry Date: 2021-11-23T20:36:14Z Registrar: Atak Domain Hosting Internet ve Bilgi Teknolojileri Limited Sirketi d/b/a Atak Teknoloji Registrar IANA ID: 1601 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS1.ODEAWEB.COM Name Server: NS2.ODEAWEB.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2020-06-11T12:47:24Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.