Tumblr.com - Thingsilikewatchingmywifedo.tumblr.com
Not found.
Domain Summary
What IP addresses does Thingsilikewatchingmywifedo.tumblr.com resolve to?
• Thingsilikewatchingmywifedo.tumblr.com resolves to the IP addresses 66.6.33.149.
Where are Thingsilikewatchingmywifedo.tumblr.com servers located in?
• Thingsilikewatchingmywifedo.tumblr.com has servers located in New York, New York, 10010, United States.
thingsilikewatchingmywifedo.tumblr.com Profile
Title:Not found.
What technologies does thingsilikewatchingmywifedo.tumblr.com use?
These are the technologies used at thingsilikewatchingmywifedo.tumblr.com. thingsilikewatchingmywifedo.tumblr.com has a total of 3 technologies installed in 3 different categories.thingsilikewatchingmywifedo.tumblr.com Traffic Analysis
There's no enough data about thingsilikewatchingmywifedo.tumblr.com traffic.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- n/a
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- thingsilikewatchingmywifedo.tumblr.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Last update was 2672 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with tumblr.com in any way. Only publicly available statistics data are displayed.
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- tumblr.com
- Last Change Time:
(The last time that the site changed status.) - 2018-06-07 02:11:52
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Passing
Desktop summary
- Root domain:
- tumblr.com
- Last Change Time:
(The last time that the site changed status.) - 2018-06-06 07:37:47
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Passing
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- tumblr.com
- Last Change Time:
(The last time that the site changed status.) - 2018-06-07 02:11:52
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Passing
Where is thingsilikewatchingmywifedo.tumblr.com hosted? ▼
Thingsilikewatchingmywifedo.tumblr.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 66.6.33.149
- ASN:
- AS26101
- ISP:
- Yahoo!
- Server Location:
- New York
New York, NY
10010
United States, US
Other sites hosted on 66.6.33.149
How fast does thingsilikewatchingmywifedo.tumblr.com load? ▼
The average loading time of thingsilikewatchingmywifedo.tumblr.com is n/a ms. The Desktop speed index is 88 and mobile speed index is 96.- Average Load Time:
- n/a ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Does thingsilikewatchingmywifedo.tumblr.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on thingsilikewatchingmywifedo.tumblr.com are reduced by %.
thingsilikewatchingmywifedo.tumblr.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. thingsilikewatchingmywifedo.tumblr.com supports HTTPS. thingsilikewatchingmywifedo.tumblr.com supports HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. thingsilikewatchingmywifedo.tumblr.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.HTTP/1.1 404 Not Found
Server: openresty
Date: Thu, 11 Oct 2018 15:09:10 GMT
Content-Type: text/html; charset=UTF-8
Connection: close
Vary: Accept-Encoding
X-Rid: 0a01145175bcb196797e8db211dc0ed8
P3p: CP="Tumblr's privacy policy is available here: https://www.tumblr.com/policy/en/privacy"
X-Frame-Options: deny
X-Xss-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Set-Cookie: pfg=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; Max-Age=0; path=/; domain=.tumblr.com; secure; HttpOnly
X-UA-Device: desktop
Vary: X-UA-Device, Accept, Accept-Encoding
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| A | 66.6.33.149 | 300 | |
| A | 66.6.32.21 | 300 | |
| A | 66.6.33.21 | 300 | |
| TXT | 300 |