Teamkennedylawnandlandscapingllc.com
Domain Summary
What is the traffic rank for Teamkennedylawnandlandscapingllc.com?
• Teamkennedylawnandlandscapingllc.com ranks #15,587,836 globally on HypeStat.
What IP addresses does Teamkennedylawnandlandscapingllc.com resolve to?
• Teamkennedylawnandlandscapingllc.com resolves to the IP addresses 34.102.136.180.
Where are Teamkennedylawnandlandscapingllc.com servers located in?
• Teamkennedylawnandlandscapingllc.com has servers located in United States.
teamkennedylawnandlandscapingllc.com Profile
What technologies does teamkennedylawnandlandscapingllc.com use?
These are the technologies used at teamkennedylawnandlandscapingllc.com. teamkennedylawnandlandscapingllc.com has a total of 4 technologies installed in 4 different categories.teamkennedylawnandlandscapingllc.com Traffic Analysis
Teamkennedylawnandlandscapingllc.com is ranked #15,587,836 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 15,587,836
Backlinks Report ▼
Teamkennedylawnandlandscapingllc.com has a total of 1 backlinks from 1 referring domains and most of them comes from China.- Total Backlinks:
- 1
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 1
- Referring IPs:
- 1
- Authority Domain Score:
- 0
Backlinks by country
- Country
- Domains
- China 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 1
- .edu
- 0
- .gov
- 0
Last update was 1181 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with teamkennedylawnandlandscapingllc.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- teamkennedylawnandlandscapingllc.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- teamkennedylawnandlandscapingllc.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- teamkennedylawnandlandscapingllc.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- teamkennedylawnandlandscapingllc.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is teamkennedylawnandlandscapingllc.com hosted? ▼
Teamkennedylawnandlandscapingllc.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 34.102.136.180
- ASN:
- AS15169
- ISP:
- Google LLC
- Server Location:
United States, US
Other sites hosted on 34.102.136.180
Does teamkennedylawnandlandscapingllc.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on teamkennedylawnandlandscapingllc.com are reduced by %.
teamkennedylawnandlandscapingllc.com does not use compression.
Original size: 2.46 KB
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. teamkennedylawnandlandscapingllc.com does not support HTTPS. teamkennedylawnandlandscapingllc.com does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. teamkennedylawnandlandscapingllc.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
TXT | 3600 | ||
TXT | 3600 | ||
MX | 3600 | ||
SOA | 3600 | ||
Mname | ns57.domaincontrol.com | ||
Rname | dns.jomax.net | ||
Serial Number | 2020070800 | ||
Refresh | 28800 | ||
Retry | 7200 | ||
Expire | 604800 | ||
Minimum TTL | 600 | ||
A | 34.102.136.180 | 540 | |
NS | 3540 | ||
NS | 3540 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 9, 2020 and will expire on May 19, 2024 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on May 19, 2024.- Domain Created:
- 2020-06-09
- Domain Age:
- 3 years 11 months 10 days
- WhoIs:
whois lookup at whois.godaddy.com...Domain Name: teamkennedylawnandlandscapingllc.com Registry Domain ID: 2535638223_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2020-06-09T06:28:38Z Creation Date: 2020-06-09T08:28:36Z Registrar Registration Expiration Date: 2021-06-09T08:28:36Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Registrant Street: DomainsByProxy.com Registrant Street: 14455 N. Hayden Road Registrant City: Scottsdale Registrant State/Province: Arizona Registrant Postal Code: 85260 Registrant Country: US Registrant Phone: +1.4806242599 Registrant Phone Ext: Registrant Fax: +1.4806242598 Registrant Fax Ext: Registrant Email: Registry Tech ID: Not Available From Registry Tech Name: Registration Private Tech Organization: Domains By Proxy, LLC Tech Street: DomainsByProxy.com Tech Street: 14455 N. Hayden Road Tech City: Scottsdale Tech State/Province: Arizona Tech Postal Code: 85260 Tech Country: US Tech Phone: +1.4806242599 Tech Phone Ext: Tech Fax: +1.4806242598 Tech Fax Ext: Tech Email: Registry Admin ID: Not Available From Registry Admin Name: Registration Private Admin Organization: Domains By Proxy, LLC Admin Street: DomainsByProxy.com Admin Street: 14455 N. Hayden Road Admin City: Scottsdale Admin State/Province: Arizona Admin Postal Code: 85260 Admin Country: US Admin Phone: +1.4806242599 Admin Phone Ext: Admin Fax: +1.4806242598 Admin Fax Ext: Admin Email: Name Server: NS57.DOMAINCONTROL.COM Name Server: NS58.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2021-02-23T00:00:59Z <<< For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en TERMS OF USE: The data contained in this registrar's Whois database, while believed by the registrar to be reliable, is provided "as is" with no guarantee or warranties regarding its accuracy. This information is provided for the sole purpose of assisting you in obtaining information about domain name registration records. Any use of this data for any other purpose is expressly forbidden without the prior written permission of this registrar. By submitting an inquiry, you agree to these terms and limitations of warranty. In particular, you agree not to use this data to allow, enable, or otherwise support the dissemination or collection of this data, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone, postal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations of any kind, including spam. You further agree not to use this data to enable high volume, automated or robotic electronic processes designed to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Failure to comply with these terms may result in termination of access to the Whois database. These terms may be subject to modification at any time without notice.whois lookup at whois.crsnic.net...Domain Name: TEAMKENNEDYLAWNANDLANDSCAPINGLLC.COM Registry Domain ID: 2535638223_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2020-06-09T13:28:37Z Creation Date: 2020-06-09T13:28:36Z Registry Expiry Date: 2021-06-09T13:28:36Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS57.DOMAINCONTROL.COM Name Server: NS58.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2021-02-23T00:00:51Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.