tumblr.com Tumblr.com - Sweetspankingvspankingfeeling.tumblr.com

   
Not found.

Domain Summary

What IP addresses does Sweetspankingvspankingfeeling.tumblr.com resolve to?

• Sweetspankingvspankingfeeling.tumblr.com resolves to the IP addresses 66.6.32.21.

Where are Sweetspankingvspankingfeeling.tumblr.com servers located in?

• Sweetspankingvspankingfeeling.tumblr.com has servers located in New York, New York, 10010, United States.

sweetspankingvspankingfeeling.tumblr.com Profile

Title:Not found.

What technologies does sweetspankingvspankingfeeling.tumblr.com use?

These are the technologies used at sweetspankingvspankingfeeling.tumblr.com. sweetspankingvspankingfeeling.tumblr.com has a total of 3 technologies installed in 3 different categories.

sweetspankingvspankingfeeling.tumblr.com Traffic Analysis

There's no enough data about sweetspankingvspankingfeeling.tumblr.com traffic.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
n/a
*All traffic values are estimates only.
Last update was 2566 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with tumblr.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  sweetspankingvspankingfeeling.tumblr.com
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
tumblr.com
Last Change Time:
(The last time that the site changed status.)
2017-09-27 17:24:06
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Passing

Desktop summary

Root domain:
tumblr.com
Last Change Time:
(The last time that the site changed status.)
2017-11-22 03:24:49
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Passing

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
tumblr.com
Last Change Time:
(The last time that the site changed status.)
2017-11-22 03:24:49
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Passing

Where is sweetspankingvspankingfeeling.tumblr.com hosted?

Sweetspankingvspankingfeeling.tumblr.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.

How fast does sweetspankingvspankingfeeling.tumblr.com load?

The average loading time of sweetspankingvspankingfeeling.tumblr.com is n/a ms. The Desktop speed index is 88 and mobile speed index is 96.
Average Load Time:
n/a ms

Page Speed (Google PageSpeed Insights) - Desktop

88
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Lab Data


Page Speed (Google PageSpeed Insights) - Mobile

96
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s)Largest Contentful Paint (LCP) 0%

Lab Data

Does sweetspankingvspankingfeeling.tumblr.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on sweetspankingvspankingfeeling.tumblr.com are reduced by %.
sweetspankingvspankingfeeling.tumblr.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. sweetspankingvspankingfeeling.tumblr.com supports HTTPS.
 sweetspankingvspankingfeeling.tumblr.com supports HTTPS
     
Verifying SSL Support. Please wait...

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 sweetspankingvspankingfeeling.tumblr.com supports HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
HTTP/1.1 404 Not Found
Server: openresty
Date: Tue, 20 Mar 2018 06:32:12 GMT
Content-Type: text/html; charset=UTF-8
Connection: close
Vary: Accept-Encoding
X-Rid: 23b588f733eaa297a849bf156b35cdd2
P3p: CP="Tumblr's privacy policy is available here: https://www.tumblr.com/policy/en/privacy"
X-Frame-Options: deny
X-Xss-Protection: 1; mode=block
X-Content-Type-Options: nosniff
X-UA-Device: desktop
Vary: X-UA-Device, Accept, Accept-Encoding