Stephanieskinnerfamilydental.com
Stephanie L. Skinner D.M.D. Family Dentistry | Savannah, GA
Domain Summary
What is the traffic rank for Stephanieskinnerfamilydental.com?
• Stephanieskinnerfamilydental.com ranks #13,680,628 globally on HypeStat.
What IP addresses does Stephanieskinnerfamilydental.com resolve to?
• Stephanieskinnerfamilydental.com resolves to the IP addresses 34.238.63.74.
Where are Stephanieskinnerfamilydental.com servers located in?
• Stephanieskinnerfamilydental.com has servers located in Ashburn, Virginia, 20149, United States.
stephanieskinnerfamilydental.com Profile
Title:Stephanie L. Skinner D.M.D. Family Dentistry | Savannah, GA
Description:Stephanie L. Skinner D.M.D. has been providing comfortable and caring family dentistry in Savannah, GA, for over 20 years.
What technologies does stephanieskinnerfamilydental.com use?
These are the technologies used at stephanieskinnerfamilydental.com. stephanieskinnerfamilydental.com has a total of 9 technologies installed in 10 different categories.stephanieskinnerfamilydental.com Traffic Analysis
Stephanieskinnerfamilydental.com is ranked #13,680,628 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 13,680,628
Last update was 2082 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with stephanieskinnerfamilydental.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- stephanieskinnerfamilydental.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- stephanieskinnerfamilydental.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- stephanieskinnerfamilydental.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- stephanieskinnerfamilydental.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is stephanieskinnerfamilydental.com hosted? ▼
Stephanieskinnerfamilydental.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 34.238.63.74
- ASN:
- AS14618
- ISP:
- Amazon.com, Inc.
- Server Location:
- Ashburn
Virginia, VA
20149
United States, US
Other sites hosted on 34.238.63.74
Does stephanieskinnerfamilydental.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on stephanieskinnerfamilydental.com are reduced by %.
stephanieskinnerfamilydental.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. stephanieskinnerfamilydental.com does not support HTTPS. stephanieskinnerfamilydental.com does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. stephanieskinnerfamilydental.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /PMORW/
HTTP/1.1 302 Found
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /
HTTP/1.1 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Expires: -1
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Sat, 13 Jul 2019 17:53:02 GMT
Content-Length: 493
Age: 7
Connection: keep-alive
Server: nginx
Date: Sat, 13 Jul 2019 17:53:06 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 0
Connection: keep-alive
X-Redirect-By: WordPress
Location: https://msnodo.net?password-protected=login&redirect_to=http%3A%2F%2Fmsnodo.net%2F
Referrer-Policy: no-referrer-when-downgrade
HTTP/2 200
server: nginx
date: Sat, 13 Jul 2019 17:53:07 GMT
content-type: text/html; charset=UTF-8
vary: Accept-Encoding
expires: Wed, 11 Jan 1984 05:00:00 GMT
cache-control: no-cache, must-revalidate, max-age=0
set-cookie: wordpress_test_cookie=WP+Cookie+check; path=/
set-cookie: wordpress_test_cookie=WP+Cookie+check; path=/wp/
vary: Accept-Encoding
referrer-policy: no-referrer-when-downgrade
content-encoding: gzip
Date: Sat, 13 Jul 2019 17:53:09 GMT
Server: Apache/2.2.31 (CentOS)
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=ISO-8859-1
Cache-Control: private, no-cache, no-store, must-revalidate, max-age=0
Pragma: no-cache
Content-Type: text/html
Cteonnt-Length: 1148
Date: Sat, 13 Jul 2019 17:53:04 GMT
Server: LiteSpeed
Connection: Keep-Alive
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 658
Date: Sat, 13 Jul 2019 17:53:10 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Server: nginx
Date: Sat, 13 Jul 2019 17:53:11 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 50
Connection: keep-alive
Location: http://www.dirtychai.space/
X-Served-By: Namecheap URL Forward
HTTP/1.1 200 OK
Server: nginx
Date: Sat, 13 Jul 2019 17:53:11 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=15
Cache-Control: no-cache
Pragma: no-cache
Expires: -1
X-CST: MISS
X-CST: MISS
Allow: GET, HEAD
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /efSLk/
HTTP/1.1 302 Found
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /
HTTP/1.1 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Expires: -1
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Sat, 13 Jul 2019 17:53:12 GMT
Content-Length: 493
Age: 3
Connection: keep-alive
Server: nginx/1.14.0
Date: Sat, 13 Jul 2019 17:53:27 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.6.38
Content-Encoding: gzip
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Content-Type: text/html; charset=UTF-8
X-Cacheable: YES:Forced
Content-Length: 6758
Accept-Ranges: bytes
Date: Sat, 13 Jul 2019 17:53:48 GMT
Age: 22192
Vary: Accept-Encoding, User-Agent
X-Cache: cached
X-Cache-Hit: HIT
X-Backend: all_requests
Date: Sat, 13 Jul 2019 17:53:49 GMT
Server: Apache
Location: http://www.pocketsurfboards.com/
Content-Length: 240
Content-Type: text/html; charset=iso-8859-1
HTTP/1.1 200 OK
Date: Sat, 13 Jul 2019 17:53:49 GMT
Server: Apache
Last-Modified: Tue, 05 Mar 2019 18:39:55 GMT
ETag: "1313-5835d330a2504-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 1675
Content-Type: text/html
Set-Cookie: rd=R3047010670; path=/; expires=Tue, 16-Jul-2019 06:05:53 GMT
Server: nginx
Date: Sat, 13 Jul 2019 17:53:51 GMT
Content-Type: text/html
Content-Length: 154
Connection: close
Location: http://www.cg-dex.com
HTTP/1.1 200 OK
Set-Cookie: rd=R3047008492; path=/; expires=Tue, 16-Jul-2019 06:05:53 GMT
Server: nginx
Date: Sat, 13 Jul 2019 17:53:52 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: close
Server: nginx/1.12.2
Date: Sat, 13 Jul 2019 17:53:54 GMT
Content-Type: text/html; charset=utf-8;
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/7.2.19
Set-Cookie: PHPSESSID=ddp50deceh0e66nld5oo6vspfv; path=/
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
0: HTTP/1.1 200 OK;
Content-Encoding: gzip
Date: Sat, 13 Jul 2019 17:53:55 GMT
Server: Apache
Location: https://stephanieskinnerfamilydental.com/
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
HTTP/1.1 200 OK
Date: Sat, 13 Jul 2019 17:53:55 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8