elitemarketingpro.com Elitemarketingpro.com - Seanlynnwyman.elitemarketingpro.com

   
Elite Marketing Pro

Domain Summary

What is the traffic rank for Seanlynnwyman.elitemarketingpro.com?

• Seanlynnwyman.elitemarketingpro.com ranks #56,930 globally on HypeStat.

What percent of global Internet users visit Seanlynnwyman.elitemarketingpro.com?

0.00257% of global Internet users visit Seanlynnwyman.elitemarketingpro.com

How many people visit Seanlynnwyman.elitemarketingpro.com each day?

• Seanlynnwyman.elitemarketingpro.com receives approximately 126.7K visitors and 344,622 page impressions per day.

Which countries does Seanlynnwyman.elitemarketingpro.com receive most of its visitors from?

• Seanlynnwyman.elitemarketingpro.com is mostly visited by people located in United States,Canada,Australia.

How much Seanlynnwyman.elitemarketingpro.com can earn?

• Seanlynnwyman.elitemarketingpro.com should earn about $1,431.86/day from advertising revenue.

What is Seanlynnwyman.elitemarketingpro.com estimated value?

• Estimated value of Seanlynnwyman.elitemarketingpro.com is $1,373,682.33.

What IP addresses does Seanlynnwyman.elitemarketingpro.com resolve to?

• Seanlynnwyman.elitemarketingpro.com resolves to the IP addresses 162.144.79.52.

Where are Seanlynnwyman.elitemarketingpro.com servers located in?

• Seanlynnwyman.elitemarketingpro.com has servers located in Provo, UT, 84606, United States.

seanlynnwyman.elitemarketingpro.com Profile

Title:Elite Marketing Pro

What technologies does seanlynnwyman.elitemarketingpro.com use?

These are the technologies used at seanlynnwyman.elitemarketingpro.com. seanlynnwyman.elitemarketingpro.com has a total of 11 technologies installed in 10 different categories.

seanlynnwyman.elitemarketingpro.com Traffic Analysis

Seanlynnwyman.elitemarketingpro.com is ranked #56,930 in the world. This website is viewed by an estimated 126.7K visitors daily, generating a total of 344.6K pageviews. This equates to about 3.8M monthly visitors.
Daily Visitors126.7K
Monthly Visits3.8M
Pages per Visit2.72
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
126,699
Monthly Visits:
3,838,980
Pages per Visit:
2.72
Daily Pageviews:
344,622
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
0.00257%
HypeRank:
56,930
SEMrush Rank:
2,538,602
*All traffic values are estimates only.

Visitors by country

Country
Users%
 
United States 33.8%
 
Canada 17.0%
 
Australia 11.0%
 
Philippines 6.9%
 
India 6.2%

Where do visitors go on seanlynnwyman.elitemarketingpro.com?

 
Reach%Pageviews%PerUser
elitemarketingpro.com
60.90%61.03%2.5
michaelmartin.elitemarketingpro.com
5.05%2.09%1.0
malpha.elitemarketingpro.com
3.59%1.73%1.2
christiancarpeso.elitemarketingpro.com
3.58%3.08%2.1
ayk.elitemarketingpro.com
3.45%1.44%1.0
Last update was 1819 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with elitemarketingpro.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  seanlynnwyman.elitemarketingpro.com
Rank:
(Rank based on keywords, cost and organic traffic)
  2,538,602
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  379
Organic Traffic:
(Number of visitors coming from top 20 search results)
  71
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $266.00

Revenue report

Google.com would generate approximately $1.4K per day if the source of income were advertisements, which equates to an estimated monthly revenue of $43K and annual gross revenue of approximately $522.6K. Based on these figures, the site's net worth is estimated at around $1.4M.

How much would seanlynnwyman.elitemarketingpro.com make?

Daily Revenue:
$1,431.86
Monthly Revenue:
$42,955.80
Yearly Revenue:
$522,628.90
*All earnings values are estimates only.

Daily earning by country

 
CountryPageviewsEarning
 
United States 110,279$532.65
 
New Zealand 6,892$35.84
 
Singapore 6,892$12.96
 
Philippines 20,677$4.14
 
India 6,892$2.62

Loss of money due to Adblock?

Daily Revenue Loss:
$259.94
Monthly Revenue Loss:
$7,798.29
Yearly Revenue Loss:
$94,879.14
Daily Pageviews Blocked:
57,276
Monthly Pageviews Blocked:
1,718,285
Yearly Pageviews Blocked:
20,905,804

Daily revenue loss by country

 
CountryBlockedLost Money
 
United States 19,850$95.88
 
New Zealand 1,654$8.60
 
Singapore 1,999$3.76
 
India 1,930$0.73
 
Philippines 1,447$0.29

How much is seanlynnwyman.elitemarketingpro.com worth?

Website Value:
$1.4M

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
elitemarketingpro.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
elitemarketingpro.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
elitemarketingpro.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is seanlynnwyman.elitemarketingpro.com hosted?

Seanlynnwyman.elitemarketingpro.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
162.144.79.52
ASN:
AS46606 
ISP:
Unified Layer 
Server Location:
Provo
UT
84606
United States
 

Other sites hosted on 162.144.79.52

How fast does seanlynnwyman.elitemarketingpro.com load?

The average loading time of seanlynnwyman.elitemarketingpro.com is 2342 ms. The Desktop speed index is 62 and mobile speed index is 100.
Average Load Time:
2342 ms

Page Speed (Google PageSpeed Insights) - Desktop

62
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Lab Data


Page Speed (Google PageSpeed Insights) - Mobile

100
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s)Largest Contentful Paint (LCP) 0%

Lab Data

Does seanlynnwyman.elitemarketingpro.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on seanlynnwyman.elitemarketingpro.com are reduced by %.
seanlynnwyman.elitemarketingpro.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. seanlynnwyman.elitemarketingpro.com does not support HTTPS.
 seanlynnwyman.elitemarketingpro.com does not support HTTPS
     
Verifying SSL Support. Please wait...

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 seanlynnwyman.elitemarketingpro.com does not support HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
HTTP/1.1 200 OK
Date: Fri, 04 Dec 2015 19:50:06 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
P3P: CP="CAO COR CURa ADMa DEVa OUR IND ONL COM DEM PRE"
Set-Cookie: PHPSESSID=7f8a9c85bdec488cf3e0ee1cc79fd7cc; path=/
Set-Cookie: wfvt_1805694159=5661ee6ee66e6; expires=Fri, 04-Dec-2015 20:20:06 GMT; path=/; httponly
Access-Control-Allow-Origin: http://elitemarketingpro.com
Access-Control-Allow-Headers: origin, x-requested-with, content-type
Access-Control-Allow-Methods: PUT, GET, POST, DELETE, OPTIONS
Cache-Control: max-age=0, private, no-store, no-cache, must-revalidate
Connection: close
Content-Type: text/html

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on January 12, 2010 and will expire on August 11, 2025 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on August 11, 2025.
Domain Created:
2010-01-12
Domain Age:
15 years 6 months 30 days
WhoIs:
 

whois lookup at whois.enom.com...Domain Name: ELITEMARKETINGPRO.COM
Registry Domain ID: 1581620963_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2013-12-11T23:55:49.00Z
Creation Date: 2010-01-12T19:17:00.00Z
Registrar Registration Expiration Date: 2016-01-12T19:17:45.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Reseller: NAMECHEAP.COM
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: 
Registrant Name: TIM ERWAY
Registrant Organization: TIM ERWAY
Registrant Street: PO BOX 353579
Registrant City: PALM COAST
Registrant State/Province: FLORIDA
Registrant Postal Code: 32135
Registrant Country: US
Registrant Phone: +1.3865972645
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext:
Registrant Email: email
Registry Admin ID: 
Admin Name: TIM ERWAY
Admin Organization: TIM ERWAY
Admin Street: PO BOX 353579
Admin City: PALM COAST
Admin State/Province: FLORIDA
Admin Postal Code: 32135
Admin Country: US
Admin Phone: +1.3865972645
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext:
Admin Email: email
Registry Tech ID: 
Tech Name: TIM ERWAY
Tech Organization: TIM ERWAY
Tech Street: PO BOX 353579
Tech City: PALM COAST
Tech State/Province: FLORIDA
Tech Postal Code: 32135
Tech Country: US
Tech Phone: +1.3865972645
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: email
Name Server: ELSA.NS.CLOUDFLARE.COM
Name Server: GREG.NS.CLOUDFLARE.COM
DNSSEC: unSigned
Registrar Abuse Contact Email: email
Registrar Abuse Contact Phone: +1.4252982646
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
Last update of WHOIS database: 2013-12-11T23:55:49.00Zwhois lookup at whois.crsnic.net...Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

   Domain Name: ELITEMARKETINGPRO.COM
   Registrar: ENOM, INC.
   Sponsoring Registrar IANA ID: 48
   Whois Server: whois.enom.com
   Referral URL: http://www.enom.com
   Name Server: ELSA.NS.CLOUDFLARE.COM
   Name Server: GREG.NS.CLOUDFLARE.COM
   Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
   Updated Date: 13-dec-2014
   Creation Date: 12-jan-2010
   Expiration Date: 12-jan-2016

>>> Last update of whois database: Fri, 04 Dec 2015 19:49:58 GMT <<<

For more information on Whois status codes, please visit
https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.