Elitemarketingpro.com - Seanlynnwyman.elitemarketingpro.com
Elite Marketing Pro
Domain Summary
What is the traffic rank for Seanlynnwyman.elitemarketingpro.com?
• Seanlynnwyman.elitemarketingpro.com ranks #56,930 globally on HypeStat.
What percent of global Internet users visit Seanlynnwyman.elitemarketingpro.com?
• 0.00257% of global Internet users visit Seanlynnwyman.elitemarketingpro.com
How many people visit Seanlynnwyman.elitemarketingpro.com each day?
• Seanlynnwyman.elitemarketingpro.com receives approximately 126.7K visitors and 344,622 page impressions per day.
Which countries does Seanlynnwyman.elitemarketingpro.com receive most of its visitors from?
• Seanlynnwyman.elitemarketingpro.com is mostly visited by people located in United States,Canada,Australia.
How much Seanlynnwyman.elitemarketingpro.com can earn?
• Seanlynnwyman.elitemarketingpro.com should earn about $1,431.86/day from advertising revenue.
What is Seanlynnwyman.elitemarketingpro.com estimated value?
• Estimated value of Seanlynnwyman.elitemarketingpro.com is $1,373,682.33.
What IP addresses does Seanlynnwyman.elitemarketingpro.com resolve to?
• Seanlynnwyman.elitemarketingpro.com resolves to the IP addresses 162.144.79.52.
Where are Seanlynnwyman.elitemarketingpro.com servers located in?
• Seanlynnwyman.elitemarketingpro.com has servers located in Provo, UT, 84606, United States.
seanlynnwyman.elitemarketingpro.com Profile
Title:Elite Marketing Pro
What technologies does seanlynnwyman.elitemarketingpro.com use?
These are the technologies used at seanlynnwyman.elitemarketingpro.com. seanlynnwyman.elitemarketingpro.com has a total of 11 technologies installed in 10 different categories.seanlynnwyman.elitemarketingpro.com Traffic Analysis
Seanlynnwyman.elitemarketingpro.com is ranked #56,930 in the world. This website is viewed by an estimated 126.7K visitors daily, generating a total of 344.6K pageviews. This equates to about 3.8M monthly visitors.Daily Visitors126.7K
Monthly Visits3.8M
Pages per Visit2.72
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 126,699
- Monthly Visits:
- 3,838,980
- Pages per Visit:
- 2.72
- Daily Pageviews:
- 344,622
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- 0.00257%
- HypeRank:
- 56,930
- SEMrush Rank:
- 2,538,602
Visitors by country
- Country
- Users%
- United States 33.8%
- Canada 17.0%
- Australia 11.0%
- Philippines 6.9%
- India 6.2%
Where do visitors go on seanlynnwyman.elitemarketingpro.com?
- Reach%Pageviews%PerUser
- elitemarketingpro.com
- 60.90%61.03%2.5
- michaelmartin.elitemarketingpro.com
- 5.05%2.09%1.0
- malpha.elitemarketingpro.com
- 3.59%1.73%1.2
- christiancarpeso.elitemarketingpro.com
- 3.58%3.08%2.1
- ayk.elitemarketingpro.com
- 3.45%1.44%1.0
Last update was 1819 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with elitemarketingpro.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- seanlynnwyman.elitemarketingpro.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 2,538,602
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 379
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 71
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $266.00
Revenue report ▼
Google.com would generate approximately $1.4K per day if the source of income were advertisements, which equates to an estimated monthly revenue of $43K and annual gross revenue of approximately $522.6K. Based on these figures, the site's net worth is estimated at around $1.4M.How much would seanlynnwyman.elitemarketingpro.com make?
- Daily Revenue:
- $1,431.86
- Monthly Revenue:
- $42,955.80
- Yearly Revenue:
- $522,628.90
Daily earning by country
- CountryPageviewsEarning
- United States 110,279$532.65
- New Zealand 6,892$35.84
- Singapore 6,892$12.96
- Philippines 20,677$4.14
- India 6,892$2.62
Loss of money due to Adblock?
- Daily Revenue Loss:
- $259.94
- Monthly Revenue Loss:
- $7,798.29
- Yearly Revenue Loss:
- $94,879.14
- Daily Pageviews Blocked:
- 57,276
- Monthly Pageviews Blocked:
- 1,718,285
- Yearly Pageviews Blocked:
- 20,905,804
Daily revenue loss by country
- CountryBlockedLost Money
- United States 19,850$95.88
- New Zealand 1,654$8.60
- Singapore 1,999$3.76
- India 1,930$0.73
- Philippines 1,447$0.29
How much is seanlynnwyman.elitemarketingpro.com worth?
- Website Value:
- $1.4M
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- elitemarketingpro.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- elitemarketingpro.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- elitemarketingpro.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is seanlynnwyman.elitemarketingpro.com hosted? ▼
Seanlynnwyman.elitemarketingpro.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 162.144.79.52
- ASN:
- AS46606
- ISP:
- Unified Layer
- Server Location:
- Provo
UT
84606
United States
Other sites hosted on 162.144.79.52
How fast does seanlynnwyman.elitemarketingpro.com load? ▼
The average loading time of seanlynnwyman.elitemarketingpro.com is 2342 ms. The Desktop speed index is 62 and mobile speed index is 100.- Average Load Time:
- 2342 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interactive To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
Does seanlynnwyman.elitemarketingpro.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on seanlynnwyman.elitemarketingpro.com are reduced by %.
seanlynnwyman.elitemarketingpro.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. seanlynnwyman.elitemarketingpro.com does not support HTTPS. seanlynnwyman.elitemarketingpro.com does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. seanlynnwyman.elitemarketingpro.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.HTTP/1.1 200 OK
Date: Fri, 04 Dec 2015 19:50:06 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
P3P: CP="CAO COR CURa ADMa DEVa OUR IND ONL COM DEM PRE"
Set-Cookie: PHPSESSID=7f8a9c85bdec488cf3e0ee1cc79fd7cc; path=/
Set-Cookie: wfvt_1805694159=5661ee6ee66e6; expires=Fri, 04-Dec-2015 20:20:06 GMT; path=/; httponly
Access-Control-Allow-Origin: http://elitemarketingpro.com
Access-Control-Allow-Headers: origin, x-requested-with, content-type
Access-Control-Allow-Methods: PUT, GET, POST, DELETE, OPTIONS
Cache-Control: max-age=0, private, no-store, no-cache, must-revalidate
Connection: close
Content-Type: text/html
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on January 12, 2010 and will expire on August 11, 2025 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on August 11, 2025.- Domain Created:
- 2010-01-12
- Domain Age:
- 15 years 6 months 30 days
- WhoIs:
whois lookup at whois.enom.com...Domain Name: ELITEMARKETINGPRO.COM Registry Domain ID: 1581620963_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.enom.com Registrar URL: www.enom.com Updated Date: 2013-12-11T23:55:49.00Z Creation Date: 2010-01-12T19:17:00.00Z Registrar Registration Expiration Date: 2016-01-12T19:17:45.00Z Registrar: ENOM, INC. Registrar IANA ID: 48 Reseller: NAMECHEAP.COM Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: TIM ERWAY Registrant Organization: TIM ERWAY Registrant Street: PO BOX 353579 Registrant City: PALM COAST Registrant State/Province: FLORIDA Registrant Postal Code: 32135 Registrant Country: US Registrant Phone: +1.3865972645 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email:Registry Admin ID: Admin Name: TIM ERWAY Admin Organization: TIM ERWAY Admin Street: PO BOX 353579 Admin City: PALM COAST Admin State/Province: FLORIDA Admin Postal Code: 32135 Admin Country: US Admin Phone: +1.3865972645 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email:
Registry Tech ID: Tech Name: TIM ERWAY Tech Organization: TIM ERWAY Tech Street: PO BOX 353579 Tech City: PALM COAST Tech State/Province: FLORIDA Tech Postal Code: 32135 Tech Country: US Tech Phone: +1.3865972645 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email:
Name Server: ELSA.NS.CLOUDFLARE.COM Name Server: GREG.NS.CLOUDFLARE.COM DNSSEC: unSigned Registrar Abuse Contact Email:
Registrar Abuse Contact Phone: +1.4252982646 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ Last update of WHOIS database: 2013-12-11T23:55:49.00Zwhois lookup at whois.crsnic.net...Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: ELITEMARKETINGPRO.COM Registrar: ENOM, INC. Sponsoring Registrar IANA ID: 48 Whois Server: whois.enom.com Referral URL: http://www.enom.com Name Server: ELSA.NS.CLOUDFLARE.COM Name Server: GREG.NS.CLOUDFLARE.COM Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Updated Date: 13-dec-2014 Creation Date: 12-jan-2010 Expiration Date: 12-jan-2016 >>> Last update of whois database: Fri, 04 Dec 2015 19:49:58 GMT <<< For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.