Savvyskepticspsychedelicforum.org
Domain Summary
What is the traffic rank for Savvyskepticspsychedelicforum.org?
• Savvyskepticspsychedelicforum.org ranks #8,198,931 globally on HypeStat.
What IP addresses does Savvyskepticspsychedelicforum.org resolve to?
• Savvyskepticspsychedelicforum.org resolves to the IP addresses 34.102.136.180.
Where are Savvyskepticspsychedelicforum.org servers located in?
• Savvyskepticspsychedelicforum.org has servers located in Kansas City, Missouri, 64184, United States.
savvyskepticspsychedelicforum.org Profile
What technologies does savvyskepticspsychedelicforum.org use?
These are the technologies used at savvyskepticspsychedelicforum.org. savvyskepticspsychedelicforum.org has a total of 6 technologies installed in 5 different categories.savvyskepticspsychedelicforum.org Traffic Analysis
Savvyskepticspsychedelicforum.org is ranked #8,198,931 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 8,198,931
Last update was 685 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with savvyskepticspsychedelicforum.org in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- savvyskepticspsychedelicforum.org
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- savvyskepticspsychedelicforum.org
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- savvyskepticspsychedelicforum.org
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- savvyskepticspsychedelicforum.org
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is savvyskepticspsychedelicforum.org hosted? ▼
Savvyskepticspsychedelicforum.org may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 34.102.136.180
- ASN:
- AS396982
- ISP:
- Google LLC
- Server Location:
- Kansas City
Missouri, MO
64184
United States, US
Other sites hosted on 34.102.136.180
How fast does savvyskepticspsychedelicforum.org load? ▼
The average loading time of savvyskepticspsychedelicforum.org is 31 ms.- Average Load Time:
- 31 ms
Does savvyskepticspsychedelicforum.org use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on savvyskepticspsychedelicforum.org are reduced by %.
savvyskepticspsychedelicforum.org does not use compression.
Original size: 2.76 KB
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. savvyskepticspsychedelicforum.org does not support HTTPS. savvyskepticspsychedelicforum.org does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. savvyskepticspsychedelicforum.org does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Server: openresty
Date: Fri, 12 May 2023 01:28:02 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 2195
Connection: keep-alive
Set-Cookie: vsid=929vr431400482321096920; expires=Wed, 10-May-2028 01:28:02 GMT; Max-Age=157680000; path=/; domain=sheridangop.org; HttpOnly
X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAKX74ixpzVyXbJprcLfbH4psP4+L2entqri0lzh6pkAaXLPIcclv6DQBeJJjGFWrBIF6QMyFwXT5CCRyjS2penECAwEAAQ==_GAOdcUvMr9QxlZ9NG6+Ca55nIvB4w/clDwuZkZIThFfmC6Y0foxPyenVSaTUxsIkmpPPD0Td1Tboz0TshFZBkQ==
Server: openresty
Date: Fri, 12 May 2023 01:28:03 GMT
Content-Type: text/html
Content-Length: 2830
Last-Modified: Fri, 12 May 2023 00:59:25 GMT
ETag: "645d8f6d-b0e"
X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAJRmzcpTevQqkWn6dJuX/N/Hxl7YxbOwy8+73ijqYSQEN+WGxrruAKtZtliWC86+ewQ0msW1W8psOFL/b00zWqsCAwEAAQ_fY8Yi/1OfNPlGf2uRiS/dZ8Lg7FqSR/xQp78G3EeYIFQVcGEEFulmD2s9opNQbHBppKP2qc6NOFe+npyJkFWdw
Cache-Control: no-cache
X-Content-Type-Options: nosniff
Set-Cookie: system=PW;Path=/;Max-Age=86400;
Set-Cookie: caf_ipaddr=67.212.187.106;Path=/;Max-Age=86400;
Set-Cookie: country=US;Path=/;Max-Age=86400;
Set-Cookie: city="";Path=/;Max-Age=86400;
Set-Cookie: traffic_target=gd;Path=/;Max-Age=86400;
Accept-Ranges: bytes
Via: 1.1 google
Server: openresty
Date: Fri, 12 May 2023 01:28:04 GMT
Content-Type: text/html
Content-Length: 2830
Last-Modified: Thu, 11 May 2023 01:08:05 GMT
ETag: "645c3ff5-b0e"
X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAJRmzcpTevQqkWn6dJuX/N/Hxl7YxbOwy8+73ijqYSQEN+WGxrruAKtZtliWC86+ewQ0msW1W8psOFL/b00zWqsCAwEAAQ_He0RjQGHqEhQnLYP0Gy+B6GjFtUG9XHWbVtNE8xU3YAfApEKOL/nTNAAANQ0vbyvMRf+/6OUmO3jsDKyOZEFFg
Cache-Control: no-cache
X-Content-Type-Options: nosniff
Set-Cookie: system=PW;Path=/;Max-Age=86400;
Set-Cookie: caf_ipaddr=67.212.187.106;Path=/;Max-Age=86400;
Set-Cookie: country=US;Path=/;Max-Age=86400;
Set-Cookie: city="";Path=/;Max-Age=86400;
Set-Cookie: traffic_target=gd;Path=/;Max-Age=86400;
Accept-Ranges: bytes
Via: 1.1 google
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 3600 | ||
Mname | ns57.domaincontrol.com | ||
Rname | dns.jomax.net | ||
Serial Number | 2023012601 | ||
Refresh | 28800 | ||
Retry | 7200 | ||
Expire | 604800 | ||
Minimum TTL | 600 | ||
A | 34.102.136.180 | 600 | |
NS | 3600 | ||
NS | 3600 |