Rachelperkynsanddwightsiemens-soundsliketreble.com
Sounds Like Treble - Rachel and Dwight, Duncan BCDomain Summary
What is the traffic rank for Rachelperkynsanddwightsiemens-soundsliketreble.com?
• Rachelperkynsanddwightsiemens-soundsliketreble.com ranks #7,138,952 globally on HypeStat.
What IP addresses does Rachelperkynsanddwightsiemens-soundsliketreble.com resolve to?
• Rachelperkynsanddwightsiemens-soundsliketreble.com resolves to the IP addresses 23.236.62.147.
Where are Rachelperkynsanddwightsiemens-soundsliketreble.com servers located in?
• Rachelperkynsanddwightsiemens-soundsliketreble.com has servers located in Mountain View, California, 94043, United States.
rachelperkynsanddwightsiemens-soundsliketreble.com Profile
Title:Sounds Like Treble - Rachel and Dwight, Duncan BC
Description:Discover Rachel Perkyns and Dwight Siemens Sounds Like Treble Music Studio in Duncan, BC!
What technologies does rachelperkynsanddwightsiemens-soundsliketreble.com use?
These are the technologies used at rachelperkynsanddwightsiemens-soundsliketreble.com. rachelperkynsanddwightsiemens-soundsliketreble.com has a total of 4 technologies installed in 5 different categories.rachelperkynsanddwightsiemens-soundsliketreble.com Traffic Analysis
Rachelperkynsanddwightsiemens-soundsliketreble.com is ranked #7,138,952 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 7,138,952
Last update was 1564 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with rachelperkynsanddwightsiemens-soundsliketreble.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- rachelperkynsanddwightsiemens-soundsliketreble.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- rachelperkynsanddwightsiemens-soundsliketreble.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- rachelperkynsanddwightsiemens-soundsliketreble.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- rachelperkynsanddwightsiemens-soundsliketreble.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is rachelperkynsanddwightsiemens-soundsliketreble.com hosted? ▼
Rachelperkynsanddwightsiemens-soundsliketreble.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 23.236.62.147
- ASN:
- AS15169
- ISP:
- Google LLC
- Server Location:
- Mountain View
California, CA
94043
United States, US
Other sites hosted on 23.236.62.147
Does rachelperkynsanddwightsiemens-soundsliketreble.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on rachelperkynsanddwightsiemens-soundsliketreble.com are reduced by 79%.
rachelperkynsanddwightsiemens-soundsliketreble.com use gzip compression.
Original size: 342.33 KB
Compressed size: 71.44 KB
File reduced by: 270.89 KB (79%)
Compressed size: 71.44 KB
File reduced by: 270.89 KB (79%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. rachelperkynsanddwightsiemens-soundsliketreble.com does not support HTTPS. rachelperkynsanddwightsiemens-soundsliketreble.com does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. rachelperkynsanddwightsiemens-soundsliketreble.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.connection: Upgrade
upgrade: h2c
HTTP/2 429
cache-control: max-age=0, private, must-revalidate
content-length: 17
date: Sun, 12 Apr 2020 05:16:01 GMT
server: nginx
set-cookie: sid=b3eab562-7c7c-11ea-87a3-dbf5c5ac3cf3; path=/; domain=.nephilimangelrecords.com; expires=Fri, 30 Apr 2088 08:30:09 GMT; max-age=2147483647; HttpOnly
Upgrade: h2c
Connection: Upgrade
HTTP/2 200
date: Thu, 01 Jan 1970 00:00:00 GMT
server: Apache
accept-ranges: none
vary: Accept-Encoding
content-encoding: gzip
cache-control: no-cache
content-length: 195
content-type: text/html; charset=UTF-8
Date: Sun, 12 Apr 2020 05:16:25 GMT
Content-Length: 0
Connection: keep-alive
expires: -1
location: https://www.rachelperkynsanddwightsiemens-soundsliketreble.com/
x-seen-by: 6ivkWfREES4Y8b2pOpzk7Owfbs+7qUVAqsIx00yI78k=,BTzakfJUbU/4CBguyutVd6K2Yutql/MbvsYyizNYz/A=,1wy2ILu/S4rlWT/R4rqCraLRI8OwLNGWc7hr3zKQKbQ=,8Jozq2XDr5/0Pv3E0yMndzA7Z6tiqnLePUULijEGi8UaWyug/ZdHQ36uOAkr89T0,x1Sj9Xv8W8xC18ngt0x3My9gbvPljJjec7giP6tLq3KsP0HQDMIXEAUeCbr3NWgOvGQ2Otd3B2C27oTTIAKJtQ==
cache-control: no-cache
content-language: en
X-Wix-Request-Id: 1586668585.11244413299563117108
HTTP/1.1 200 OK
Date: Sun, 12 Apr 2020 05:16:25 GMT
Content-Type: text/html;charset=utf-8
Connection: keep-alive
Content-Language: en
Link: <https://static.parastorage.com/>; rel=preconnect; crossorigin,<https://fonts.gstatic.com>; rel=preconnect; crossorigin,<https://static.wixstatic.com/>; rel=preconnect;,<https://static.parastorage.com/unpkg/requirejs-bolt@2.3.6/requirejs.min.js>; rel=preload; as=script;,<https://static.parastorage.com/unpkg/lodash@4.17.15/lodash.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.parastorage.com/unpkg/zepto@1.2.0/dist/zepto.min.js>; rel=preload; as=script ; crossorigin=anonymous;,<https://static.wixstatic.com/>; rel=preconnect; crossorigin;,<https://www.rachelperkynsanddwightsiemens-soundsliketreble.com/_api/v2/dynamicmodel>; rel=preload; as=fetch ; crossorigin=anonymous;,<https://static.parastorage.com/services/wix-bolt/1.5611.0/bolt-main/app/main-r.min.js>; rel=preload; as=script ; crossorigin=anonymous;
X-Wix-Request-Id: 1586668585.46536407250241261512
Age: 0
Set-Cookie: ssr-caching="cache,desc=miss#varnish=miss#dc#desc=96";Version=1;Expires=Sun, 12-Apr-2020 05:16:45 GMT;Max-Age=20
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=96
X-Seen-By: 6ivkWfREES4Y8b2pOpzk7CWfEJXUOf1J0Ah0dFlolkk=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVgBpJwWrxBl3XR4ktIMcpPn,2d58ifebGbosy5xc+FRalmLduWKCAcUQR9UoZSdT8of2nYXr8tu4TSz1HJc3b/cNVh5YZ/e23tlWs0YDz5yXYA==,2UNV7KOq4oGjA5+PKsX47G2o7aXbmXm70pfAk2Bqy3s=,m0j2EEknGIVUW/liY8BLLpUGC5DTSq3W1061tSCWHcU=,1wy2ILu/S4rlWT/R4rqCrf6uGro80RN9Gm+1xjDi3FQ=,pglrwSJCjYpA6tXbCNiuHNQmLTHU/68eYF899MjmisugowPZoFypLBGfyfDz3+FB4eAr0ogoCf2Yw0iXGoMBhQ==,I2ZOrNA1LIowGTY6Ll7mx6Fk55ILI3YlgFF00HiDiRA=,1wy2ILu/S4rlWT/R4rqCrYAob1obAkiNvs57ft6S1I4=,Tw2AanFDQ+Wwo8Xxk6ZL7vOBx+hvh2Cbd7MMNUXzbHFjEJW5nZGTXMP5WuvNtL2VTh4YZluaPbJw/laM8+kJgVc1lF2cxUR5l1lUXgjqPdA=,I2ZOrNA1LIowGTY6Ll7mx8cBoAoTEa15BQ9EVHPhh3o=,1wy2ILu/S4rlWT/R4rqCrbwzwaTdV46v3H98eV9Tx1Y=,CU5GbgCT5nWPaA3tUS4mLDyWwH1DsMaW51BJtVYtUc65PrGMubnSO3ijVhrKvuQvzwQn8PFwvTtWtgUPnyp07kxXB9IWw+turvzXtUAyRpk=
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
set-cookie: hs=-1972465072; Path=/; Domain=www.rachelperkynsanddwightsiemens-soundsliketreble.com; HTTPOnly
set-cookie: svSession=d11670448588c85afbb8fa6c0636ae0bc656846e8cda55cf586fa7a37f253be74544b5bc6fbf9efeacc05c34d497e4ff1e60994d53964e647acf431e4f798bcd39f2949452d0ec5213f3bb12bcc6e13c2f80cc3929b6b588e9a9fb9f70d5f112; Max-Age=63071999; Expires=Tue, 12 Apr 2022 05:16:24 GMT; Path=/; Domain=www.rachelperkynsanddwightsiemens-soundsliketreble.com
set-cookie: XSRF-TOKEN=1586668585|k7tBgCJ_wGk9; Path=/; Domain=www.rachelperkynsanddwightsiemens-soundsliketreble.com
cache-control: private,max-age=0,must-revalidate
Content-Encoding: gzip
Set-Cookie: TS01e85bed=01b84e286a15f2bc04c80d78e077de9ed1b7cac67225a8a6d20df2eeec0241a0ed296046e60a5c6b016857e858493878bbb9853feb685ec4745ee0ad5b3e45a8198f86848a; Path=/
Set-Cookie: TS01f685ed=01b84e286a806fdefb6472cef28505816a7e858daf25a8a6d20df2eeec0241a0ed296046e6a88e2588ffe64280e08f95436c6383c488c0bab9ba2e01375fc226ab658f6f3dcc4e0140e879a151a5e737bbfc67dddbd4d92150cb07a6385be37c9575e8ac12; path=/; domain=www.rachelperkynsanddwightsiemens-soundsliketreble.com
Transfer-Encoding: chunked
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 3600 | ||
Mname | ns6.wixdns.net | ||
Rname | support.wix.com | ||
Serial Number | 2019050701 | ||
Refresh | 10800 | ||
Retry | 3600 | ||
Expire | 604800 | ||
Minimum TTL | 3600 | ||
A | 23.236.62.147 | 3597 | |
NS | 3596 | ||
NS | 3596 |