previewsitesmediasmacksiteserver.com Previewsitesmediasmacksiteserver.com

   

Domain Summary

What is the traffic rank for Previewsitesmediasmacksiteserver.com?

• Previewsitesmediasmacksiteserver.com ranks #1,392,212 globally on HypeStat.

What percent of global Internet users visit Previewsitesmediasmacksiteserver.com?

1.9E-5% of global Internet users visit Previewsitesmediasmacksiteserver.com

How many people visit Previewsitesmediasmacksiteserver.com each day?

• Previewsitesmediasmacksiteserver.com receives approximately 0.9K visitors and 8,055 page impressions per day.

How much Previewsitesmediasmacksiteserver.com can earn?

• Previewsitesmediasmacksiteserver.com should earn about $32.87/day from advertising revenue.

What is Previewsitesmediasmacksiteserver.com estimated value?

• Estimated value of Previewsitesmediasmacksiteserver.com is $31,402.19.

What IP addresses does Previewsitesmediasmacksiteserver.com resolve to?

• Previewsitesmediasmacksiteserver.com resolves to the IP addresses 185.62.238.105.

Where are Previewsitesmediasmacksiteserver.com servers located in?

• Previewsitesmediasmacksiteserver.com has servers located in Bulgaria.

previewsitesmediasmacksiteserver.com Profile

What technologies does previewsitesmediasmacksiteserver.com use?

These are the technologies used at previewsitesmediasmacksiteserver.com. previewsitesmediasmacksiteserver.com has a total of 1 technologies installed in 2 different categories.

previewsitesmediasmacksiteserver.com Traffic Analysis

Previewsitesmediasmacksiteserver.com is ranked #1,392,212 in the world. This website is viewed by an estimated 0.9K visitors daily, generating a total of 8.1K pageviews. This equates to about 28.4K monthly visitors.
Daily Visitors0.9K
Monthly Visits28.4K
Pages per Visit8.60
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
937
Monthly Visits:
28,391
Pages per Visit:
8.60
Daily Pageviews:
8,055
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
1.9E-5%
HypeRank:
1,392,212
*All traffic values are estimates only.
Last update was 2233 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with previewsitesmediasmacksiteserver.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  previewsitesmediasmacksiteserver.com
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Revenue report

Google.com would generate approximately $32.9 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $1K and annual gross revenue of approximately $12K. Based on these figures, the site's net worth is estimated at around $31.4K.

How much would previewsitesmediasmacksiteserver.com make?

Daily Revenue:
$32.87
Monthly Revenue:
$986.10
Yearly Revenue:
$11,997.55
*All earnings values are estimates only.

How much is previewsitesmediasmacksiteserver.com worth?

Website Value:
$31.4K

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
previewsitesmediasmacksiteserver.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
previewsitesmediasmacksiteserver.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
previewsitesmediasmacksiteserver.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is previewsitesmediasmacksiteserver.com hosted?

Previewsitesmediasmacksiteserver.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
185.62.238.105
ASN:
AS32475 
ISP:
SingleHop, Inc. 
Server Location:

Bulgaria, BG
 

Other sites hosted on 185.62.238.105

There are no other sites hosted on this IP

How fast does previewsitesmediasmacksiteserver.com load?

The average loading time of previewsitesmediasmacksiteserver.com is n/a ms. The Desktop speed index is 80 and mobile speed index is 83.
Average Load Time:
n/a ms

Page Speed (Google PageSpeed Insights) - Desktop

80
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Lab Data


Page Speed (Google PageSpeed Insights) - Mobile

83
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s)Largest Contentful Paint (LCP) 0%

Lab Data

Does previewsitesmediasmacksiteserver.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on previewsitesmediasmacksiteserver.com are reduced by %.
previewsitesmediasmacksiteserver.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. previewsitesmediasmacksiteserver.com supports HTTPS.
 previewsitesmediasmacksiteserver.com supports HTTPS
     
Verifying SSL Support. Please wait...
Common Name: previewsitesmediasmacksiteserver.com
Organization:
Location:
Issuer: Let's Encrypt Authority X3
Valid from: May 30 12:43:07 2019 GMT
Valid until: Aug 28 12:43:07 2019 GMT
Authority:
Keysize:

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 previewsitesmediasmacksiteserver.com supports HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
Server: nginx
Date: Tue, 18 Jun 2019 06:42:03 GMT
Content-Type: text/html
Content-Length: 419
Connection: keep-alive
Last-Modified: Thu, 05 Jul 2018 14:22:06 GMT
ETag: "1a3-570414593b42f"
Host-Header: 192fc2e7e50945beb8231a492d6a8024
X-Proxy-Cache: MISS
alt-svc: quic=":443"; ma=86400; v="43,39"
Accept-Ranges: bytes

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on December 7, 2016 and will expire on July 29, 2025 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on July 29, 2025.
Domain Created:
2016-12-07
Domain Age:
8 years 7 months 22 days
WhoIs:
 

whois lookup at whois.tucows.com...Domain Name: PREVIEWSITESMEDIASMACKSITESERVER.COM
Registry Domain ID: 2079871286_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://tucowsdomains.com
Updated Date: 2018-11-22T07:03:10
Creation Date: 2016-12-07T15:27:57
Registrar Registration Expiration Date: 2019-12-07T15:27:57
Registrar: TUCOWS, INC.
Registrar IANA ID: 69
Reseller: SG Hosting Inc.
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: 
Registrant Name: Contact Privacy Inc. Customer 0146710399
Registrant Organization: Contact Privacy Inc. Customer 0146710399
Registrant Street: 96 Mowat Ave 
Registrant City: Toronto
Registrant State/Province: ON
Registrant Postal Code: M6K 3M1
Registrant Country: CA
Registrant Phone: +1.4165385457
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: email
Registry Admin ID: 
Admin Name: Contact Privacy Inc. Customer 0146710399
Admin Organization: Contact Privacy Inc. Customer 0146710399
Admin Street: 96 Mowat Ave 
Admin City: Toronto
Admin State/Province: ON
Admin Postal Code: M6K 3M1
Admin Country: CA
Admin Phone: +1.4165385457
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: email
Registry Tech ID: 
Tech Name: Contact Privacy Inc. Customer 0146710399
Tech Organization: Contact Privacy Inc. Customer 0146710399
Tech Street: 96 Mowat Ave 
Tech City: Toronto
Tech State/Province: ON
Tech Postal Code: M6K 3M1
Tech Country: CA
Tech Phone: +1.4165385457
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: email
Name Server: ns1.c40785.sgvps.net
Name Server: ns2.c40785.sgvps.net
DNSSEC: unsigned
Registrar Abuse Contact Email: email
Registrar Abuse Contact Phone: +1.4165350123
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2018-11-22T07:03:10 <<<

"For more information on Whois status codes, please visit https://icann.org/epp"

Registration Service Provider:
    SG Hosting Inc., email
    +1.8008289231
    This company may be contacted for domain login/passwords,
    DNS/Nameserver changes, and general domain support questions.

The Data in the Tucows Registrar WHOIS database is provided to you by Tucows
for information purposes only, and may be used to assist you in obtaining
information about or related to a domain name's registration record.

Tucows makes this information available "as is," and does not guarantee its
accuracy.

By submitting a WHOIS query, you agree that you will use this data only for
lawful purposes and that, under no circumstances will you use this data to:
a) allow, enable, or otherwise support the transmission by e-mail,
telephone, or facsimile of mass, unsolicited, commercial advertising or
solicitations to entities other than the data recipient's own existing
customers; or (b) enable high volume, automated, electronic processes that
send queries or data to the systems of any Registry Operator or
ICANN-Accredited registrar, except as reasonably necessary to register
domain names or modify existing registrations.

The compilation, repackaging, dissemination or other use of this Data is
expressly prohibited without the prior written consent of Tucows.

Tucows reserves the right to terminate your access to the Tucows WHOIS
database in its sole discretion, including without limitation, for excessive
querying of the WHOIS database or for failure to otherwise abide by this
policy.

Tucows reserves the right to modify these terms at any time.

By submitting this query, you agree to abide by these terms.

NOTE: THE WHOIS DATABASE IS A CONTACT DATABASE ONLY.  LACK OF A DOMAIN
RECORD DOES NOT SIGNIFY DOMAIN AVAILABILITY.whois lookup at whois.crsnic.net...Domain Name: PREVIEWSITESMEDIASMACKSITESERVER.COM
   Registry Domain ID: 2079871286_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.tucows.com
   Registrar URL: http://www.tucows.com
   Updated Date: 2018-11-22T07:03:10Z
   Creation Date: 2016-12-07T15:27:57Z
   Registry Expiry Date: 2019-12-07T15:27:57Z
   Registrar: Tucows Domains Inc.
   Registrar IANA ID: 69
   Registrar Abuse Contact Email:
   Registrar Abuse Contact Phone:
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
   Name Server: NS1.C40785.SGVPS.NET
   Name Server: NS2.C40785.SGVPS.NET
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-06-18T06:42:25Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar.  Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability.  VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.