Nononsensefatmeltingsystemreviews.com
No Nonsense Fat Melting System Review - Does It Work? PDF Download!Domain Summary
What is the traffic rank for Nononsensefatmeltingsystemreviews.com?
• Nononsensefatmeltingsystemreviews.com ranks #15,356,690 globally on HypeStat.
What IP addresses does Nononsensefatmeltingsystemreviews.com resolve to?
• Nononsensefatmeltingsystemreviews.com resolves to the IP addresses 173.237.137.16.
Where are Nononsensefatmeltingsystemreviews.com servers located in?
• Nononsensefatmeltingsystemreviews.com has servers located in Saint Louis, MO, 63131, United States.
nononsensefatmeltingsystemreviews.com Profile
Title:No Nonsense Fat Melting System Review - Does It Work? PDF Download!
Description:Don’t buy Ted Tanner's No Nonsense Fat Melting System before Reading this Review! Find out if this product really works, and if its the right for you.
What technologies does nononsensefatmeltingsystemreviews.com use?
These are the technologies used at nononsensefatmeltingsystemreviews.com. nononsensefatmeltingsystemreviews.com has a total of 3 technologies installed in 3 different categories.nononsensefatmeltingsystemreviews.com Traffic Analysis
Nononsensefatmeltingsystemreviews.com is ranked #15,356,690 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 15,356,690
Last update was 2554 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with nononsensefatmeltingsystemreviews.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- nononsensefatmeltingsystemreviews.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- nononsensefatmeltingsystemreviews.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- nononsensefatmeltingsystemreviews.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- nononsensefatmeltingsystemreviews.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is nononsensefatmeltingsystemreviews.com hosted? ▼
Nononsensefatmeltingsystemreviews.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 173.237.137.16
- ASN:
- AS36024
- ISP:
- Colo4, LLC
- Server Location:
- Saint Louis
MO
63131
United States
Other sites hosted on 173.237.137.16
There are no other sites hosted on this IPHow fast does nononsensefatmeltingsystemreviews.com load? ▼
The average loading time of nononsensefatmeltingsystemreviews.com is n/a ms. The Desktop speed index is 64 and mobile speed index is 66.- Average Load Time:
- n/a ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Lab Data
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Lab Data
Does nononsensefatmeltingsystemreviews.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on nononsensefatmeltingsystemreviews.com are reduced by %.
nononsensefatmeltingsystemreviews.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. nononsensefatmeltingsystemreviews.com does not support HTTPS. nononsensefatmeltingsystemreviews.com does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. nononsensefatmeltingsystemreviews.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.HTTP/1.1 200 OK
Server: nginx
Date: Fri, 23 Jun 2017 08:52:58 GMT
Content-Type: text/html; charset=UTF-8
Connection: close
Vary: Accept-Encoding
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link: <http://www.nononsensefatmeltingsystemreviews.com/wp-json/>; rel="https://api.w.org/", <http://www.nononsensefatmeltingsystemreviews.com/>; rel=shortlink
Set-Cookie: PHPSESSID=idau9dp9ftrd1jg34b1b2opi60; path=/
ngpass_ngall: 1
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
TXT | 3600 | ||
MX | 3600 | ||
A | 173.237.137.16 | 3600 | |
SOA | 3600 | ||
Mname | ns1.speedydns.net | ||
Rname | none.none.com | ||
Serial Number | 2017061704 | ||
Refresh | 3600 | ||
Retry | 7200 | ||
Expire | 1209600 | ||
Minimum TTL | 86400 | ||
NS | 3600 | ||
NS | 3600 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 17, 2017 and will expire on June 20, 2024 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on June 20, 2024.- Domain Created:
- 2017-06-17
- Domain Age:
- 7 years 3 days
- WhoIs:
whois lookup at whois.godaddy.com...Domain Name: nononsensefatmeltingsystemreviews.com Registrar URL: http://www.godaddy.com Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Name Server: NS1.SPEEDYDNS.NET Name Server: NS2.SPEEDYDNS.NET DNSSEC: unsigned For complete domain details go to: http://who.godaddy.com/whoischeck.aspx?domain=nononsensefatmeltingsystemreviews.com The data contained in GoDaddy.com, LLC's WhoIs database, while believed by the company to be reliable, is provided "as is" with no guarantee or warranties regarding its accuracy. This information is provided for the sole purpose of assisting you in obtaining information about domain name registration records. Any use of this data for any other purpose is expressly forbidden without the prior written permission of GoDaddy.com, LLC. By submitting an inquiry, you agree to these terms of usage and limitations of warranty. In particular, you agree not to use this data to allow, enable, or otherwise make possible, dissemination or collection of this data, in part or in its entirety, for any purpose, such as the transmission of unsolicited advertising and and solicitations of any kind, including spam. You further agree not to use this data to enable high volume, automated or robotic electronic processes designed to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Please note: the registrant of the domain name is specified in the "registrant" section. In most cases, GoDaddy.com, LLC is not the registrant of domain names listed in this database.whois lookup at whois.crsnic.net...Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: NONONSENSEFATMELTINGSYSTEMREVIEWS.COM Registrar: GODADDY.COM, LLC Sponsoring Registrar IANA ID: 146 Whois Server: whois.godaddy.com Referral URL: http://www.godaddy.com Name Server: NS1.SPEEDYDNS.NET Name Server: NS2.SPEEDYDNS.NET Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 17-jun-2017 Creation Date: 17-jun-2017 Expiration Date: 17-jun-2018 >>> Last update of whois database: Fri, 23 Jun 2017 08:52:46 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.