Madawaskavalleyfishandgameclub.ca
MADAWASKA VALLEY FISH & GAME CLUB - Home
Domain Summary
What IP addresses does Madawaskavalleyfishandgameclub.ca resolve to?
• Madawaskavalleyfishandgameclub.ca resolves to the IP addresses 199.34.228.79.
Where are Madawaskavalleyfishandgameclub.ca servers located in?
• Madawaskavalleyfishandgameclub.ca has servers located in United States.
madawaskavalleyfishandgameclub.ca Profile
Title:MADAWASKA VALLEY FISH & GAME CLUB - Home
What technologies does madawaskavalleyfishandgameclub.ca use?
These are the technologies used at madawaskavalleyfishandgameclub.ca. madawaskavalleyfishandgameclub.ca has a total of 7 technologies installed in 7 different categories.madawaskavalleyfishandgameclub.ca Traffic Analysis
There's no enough data about madawaskavalleyfishandgameclub.ca traffic.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- n/a
- SEMrush Rank:
- 24,146,128
Backlinks Report ▼
Madawaskavalleyfishandgameclub.ca has a total of 14 backlinks from 9 referring domains and most of them comes from Moldova.- Total Backlinks:
- 14
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 9
- Referring IPs:
- 9
- Authority Domain Score:
- 2
Backlinks by country
- Country
- Domains
- Moldova 2
- United States 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 3
- .dev
- 2
- .net
- 2
- .edu
- 0
- .gov
- 0
Last update was 11 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with madawaskavalleyfishandgameclub.ca in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- madawaskavalleyfishandgameclub.ca
- Rank:
(Rank based on keywords, cost and organic traffic) - 24,146,128
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 3
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- madawaskavalleyfishandgameclub.ca
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- madawaskavalleyfishandgameclub.ca
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- madawaskavalleyfishandgameclub.ca
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is madawaskavalleyfishandgameclub.ca hosted? ▼
Madawaskavalleyfishandgameclub.ca may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 199.34.228.79
- ASN:
- AS27647
- ISP:
- Weebly, Inc.
- Server Location:
United States, US
Other sites hosted on 199.34.228.79
How fast does madawaskavalleyfishandgameclub.ca load? ▼
The average loading time of madawaskavalleyfishandgameclub.ca is 800 ms. The Desktop speed index is 83 and mobile speed index is 0.- Average Load Time:
- 800 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0
Time To First Byte (TTFB)0
First Contentful Paint (FCP)0
First Input Delay (FID)0
Interaction To Next Paint (INP)0
Largest Contentful Paint (LCP)0
Lab Data
First Contentful Paint 1.0 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Speed Index 1.7 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Time to Interactive 2.4 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Max Potential First Input Delay 120 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Total Blocking Time 100 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Largest Contentful Paint 1.9 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Does madawaskavalleyfishandgameclub.ca use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on madawaskavalleyfishandgameclub.ca are reduced by 76%.
madawaskavalleyfishandgameclub.ca use gzip compression.
Original size: 37.08 KB
Compressed size: 8.89 KB
File reduced by: 28.18 KB (76%)
Compressed size: 8.89 KB
File reduced by: 28.18 KB (76%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. madawaskavalleyfishandgameclub.ca supports HTTPS. madawaskavalleyfishandgameclub.ca supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.madawaskavalleyfishandgameclub.ca
Organization:
Location:
Issuer: R11
Valid from: Aug 19 02:14:51 2025 GMT
Valid until: Nov 17 02:14:50 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R11
Valid from: Aug 19 02:14:51 2025 GMT
Valid until: Nov 17 02:14:50 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R11
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. madawaskavalleyfishandgameclub.ca supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.date: Fri, 24 Oct 2025 10:56:10 GMT
content-type: text/html; charset=iso-8859-1
location: https://www.madawaskavalleyfishandgameclub.ca/
server: cloudflare
cf-ray: 9938f22dfe71dc72-FRA
cf-cache-status: BYPASS
vary: Accept-Encoding
set-cookie: __cf_bm=PmfdGkLZlBxdgwdxctierF3_ZwFIc7E3NsAm7skSxt8-1761303370-1.0.1.1-R61wlAaQ2jg7OKbGJDP0OsmO48CyBk5w2l5TOPmVAcVF9H3CV_.Lz0wasEGee_95JS5PzNWIS90FPFuNEdKmazOq8ZAHYgtr_k2EB98QDlI; path=/; expires=Fri, 24-Oct-25 11:26:10 GMT; domain=.madawaskavalleyfishandgameclub.ca; HttpOnly; Secure; SameSite=None
HTTP/2 200
date: Fri, 24 Oct 2025 10:56:10 GMT
content-type: text/html; charset=UTF-8
content-encoding: gzip
cf-ray: 9938f230ddcf4e6c-FRA
cf-cache-status: EXPIRED
cache-control: private, max-age=30, no-store
last-modified: Fri, 24 Oct 2025 10:56:10 GMT
vary: Accept-Encoding,User-Agent
cdn-cache-control: max-age=30, public
x-host: blu64.sf2p.intern.weebly.net
x-ua-compatible: IE=edge,chrome=1
set-cookie: __cf_bm=QboFlxrwtnt1.l9mC3D1qsNN6aYItNLE6iUx.8kxrGQ-1761303370-1.0.1.1-rKCh8t5QbG9XsypZkSH5Lxws.E93CbsJ93P4yp.x8QC3qHzK5II3q9SlF8.zrrJy8tY3eMdYV3Ta9kCX2lGELC_7V62YsSjtbOeEQvvPlOI; path=/; expires=Fri, 24-Oct-25 11:26:10 GMT; domain=.www.madawaskavalleyfishandgameclub.ca; HttpOnly; Secure; SameSite=None
server: cloudflare
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| TXT | 14400 | ||
| MX | 14400 | ||
| SOA | 86400 | ||
| Mname | ns1.whc.ca | ||
| Rname | sysadmin.whc.ca | ||
| Serial Number | 2025100904 | ||
| Refresh | 3600 | ||
| Retry | 1800 | ||
| Expire | 1209600 | ||
| Minimum TTL | 86400 | ||
| NS | 86400 | ||
| NS | 86400 | ||
| NS | 86400 | ||
| A | 199.34.228.79 | 14400 |