kleansweepcleaningservices.info Kleansweepcleaningservices.info

   
Bluetoonroots

Domain Summary

What is the traffic rank for Kleansweepcleaningservices.info?

• Kleansweepcleaningservices.info ranks #17,537,673 globally on HypeStat.

What IP addresses does Kleansweepcleaningservices.info resolve to?

• Kleansweepcleaningservices.info resolves to the IP addresses 50.63.202.37.

Where are Kleansweepcleaningservices.info servers located in?

• Kleansweepcleaningservices.info has servers located in Scottsdale, Arizona, 85260, United States.

kleansweepcleaningservices.info Profile

Title:Bluetoonroots Description:family History Peterhead Aberdeenshire Banff Buchan Scotland Garden Ancestory Fishing North East 1800's 1900's Garden Bluetoon Bluemoggner

What technologies does kleansweepcleaningservices.info use?

These are the technologies used at kleansweepcleaningservices.info. kleansweepcleaningservices.info has a total of 1 technologies installed in 1 different categories.

kleansweepcleaningservices.info Traffic Analysis

Kleansweepcleaningservices.info is ranked #17,537,673 in the world.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
17,537,673
*All traffic values are estimates only.
Last update was 2121 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with kleansweepcleaningservices.info in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  kleansweepcleaningservices.info
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
kleansweepcleaningservices.info
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
kleansweepcleaningservices.info
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
kleansweepcleaningservices.info
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is kleansweepcleaningservices.info hosted?

Kleansweepcleaningservices.info may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
50.63.202.37
ASN:
AS26496 
ISP:
GoDaddy.com, LLC 
Server Location:
Scottsdale
Arizona, AZ
85260
United States, US
 

Other sites hosted on 50.63.202.37

Does kleansweepcleaningservices.info use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on kleansweepcleaningservices.info are reduced by 82%.
kleansweepcleaningservices.info use gzip compression.
Original size: 60.57 KB
Compressed size: 10.74 KB
File reduced by: 49.83 KB (82%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. kleansweepcleaningservices.info does not support HTTPS.
 kleansweepcleaningservices.info does not support HTTPS
     
Verifying SSL Support. Please wait...

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 kleansweepcleaningservices.info does not support HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
Date: Tue, 14 Apr 2020 11:02:18 GMT
Server: Apache
X-Xss-Protection: 1; mode=block
Referrer-Policy: no-referrer-when-downgrade
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8
Connection: Keep-Alive
Content-Type: text/html; charset=UTF-8
X-Pingback: http://eloyblanco.com/xmlrpc.php
X-Redirect-By: WordPress
Location: https://eloyblanco.com/
X-LiteSpeed-Cache: hit
Content-Length: 0
Date: Tue, 14 Apr 2020 11:02:20 GMT

HTTP/2 200 
content-type: text/html; charset=UTF-8
x-pingback: https://eloyblanco.com/xmlrpc.php
link: <https://eloyblanco.com/wp-json/>; rel="https://api.w.org/"
link: <https://eloyblanco.com/>; rel=shortlink
etag: "3359-1586811024;br"
x-litespeed-cache: hit
content-encoding: br
vary: Accept-Encoding
content-length: 8395
date: Tue, 14 Apr 2020 11:02:20 GMT
alt-svc: quic=":443"; ma=2592000; v="43,46", h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-25=":443"; ma=2592000, h3-27=":443"; ma=2592000
Date: Tue, 14 Apr 2020 11:02:23 GMT
Server: Apache
Location: https://emmasantenna.com/
Content-Length: 299
Content-Type: text/html; charset=iso-8859-1

HTTP/2 301 
date: Tue, 14 Apr 2020 11:02:23 GMT
server: Apache
x-redirect-by: WordPress
vary: User-Agent
location: https://www.emmasantenna.com/
content-length: 0
content-type: text/html; charset=UTF-8

HTTP/2 200 
date: Tue, 14 Apr 2020 11:02:26 GMT
server: Apache
link: <https://www.emmasantenna.com/wp-json/>; rel="https://api.w.org/", <https://www.emmasantenna.com/>; rel=shortlink
vary: User-Agent,Accept-Encoding
content-encoding: gzip
content-length: 10440
content-type: text/html; charset=UTF-8
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Expires: -1
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Tue, 14 Apr 2020 11:02:38 GMT
Content-Length: 473
Age: 0
Connection: keep-alive
Date: Tue, 14 Apr 2020 11:02:44 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=dcec2e4d27dbf6f8598c9f7f9813a01fc1586862164; expires=Thu, 14-May-20 11:02:44 GMT; path=/; domain=.pixelshoe.com; HttpOnly; SameSite=Lax
X-Sorting-Hat-PodId: -1
Vary: Accept-Encoding
X-Frame-Options: DENY
Vary: Accept
X-Request-Id: fcdccc6d-dd74-407d-8773-f8e9bf3a0dc7
X-Shopify-Stage: production
Content-Security-Policy: frame-ancestors 'none'; report-uri /csp-report?source%5Baction%5D=index&source%5Bapp%5D=Shopify&source%5Bcontroller%5D=storefront_section%2Fshop&source%5Bsection%5D=storefront&source%5Buuid%5D=fcdccc6d-dd74-407d-8773-f8e9bf3a0dc7
X-Content-Type-Options: nosniff
X-Download-Options: noopen
X-Permitted-Cross-Domain-Policies: none
X-XSS-Protection: 1; mode=block; report=/xss-report?source%5Baction%5D=index&source%5Bapp%5D=Shopify&source%5Bcontroller%5D=storefront_section%2Fshop&source%5Bsection%5D=storefront&source%5Buuid%5D=fcdccc6d-dd74-407d-8773-f8e9bf3a0dc7
X-Dc: gcp-us-central1,gcp-us-central1
Content-Encoding: gzip
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 583cefafdf6bc633-MSP
alt-svc: h3-27=":443"; ma=86400, h3-25=":443"; ma=86400, h3-24=":443"; ma=86400, h3-23=":443"; ma=86400
Date: Tue, 14 Apr 2020 11:02:58 GMT
Server: Apache/2.2.15 (CentOS)
Accept-Ranges: bytes
Content-Length: 4961
Connection: close
Content-Type: text/html; charset=UTF-8
Date: Tue, 14 Apr 2020 11:02:47 GMT
Server: Apache/2.4.6
Content-Length: 202
Content-Type: text/html; charset=iso-8859-1
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Expires: -1
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Tue, 14 Apr 2020 11:03:27 GMT
Content-Length: 497
Age: 1
Connection: keep-alive
location: https://bluetoonroots.com/
Vary: Accept-Encoding
Server: DPS/1.8.1
X-SiteId: 1000
Set-Cookie: dps_site_id=1000; path=/
ETag: 4a2471d5d9bb26225b7762512ca1b978
Date: Tue, 14 Apr 2020 11:03:29 GMT
Connection: keep-alive
Transfer-Encoding: chunked

HTTP/2 200 
link: <https://img1.wsimg.com/poly/v2/polyfill.min.js?unknown=polyfill&flags=gated&features=default%2Cfetch%2CArray.prototype.%40%40iterator%2CArray.prototype.find%2CArray.prototype.findIndex%2CFunction.name%2CNumber.isFinite%2CPromise%2CString.prototype.repeat%2CMath.sign%2CMath.trunc%2CArray.prototype.includes%2CObject.entries%2CObject.values%2CIntersectionObserver%2CIntl.~locale.en-GB>; rel=preload; as=script; crossorigin,<//img1.wsimg.com/blobby/go/gpub/2a4f73fcd74c5421/script.js>; rel=preload; as=script; crossorigin,<//img1.wsimg.com/ceph-p3-01/website-builder-data-prod/static/widgets/UX.3.55.84.js>; rel=preload; as=script; crossorigin,<https://img1.wsimg.com/gfonts/s/montserrat/v14/JTURjIg1_i6t8kCHKm45_bZF3gnD-w.ttf>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/montserrat/v14/JTURjIg1_i6t8kCHKm45_dJE3gnD-w.ttf>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/roboto/v20/KFOjCnqEu92Fr1Mu51TjASc6CsE.ttf>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/roboto/v20/KFOkCnqEu92Fr1Mu51xIIzc.ttf>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/roboto/v20/KFOjCnqEu92Fr1Mu51TzBic6CsE.ttf>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/roboto/v20/KFOkCnqEu92Fr1MmgVxIIzc.ttf>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/roboto/v20/KFOlCnqEu92Fr1MmSU5fBBc9.ttf>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/roboto/v20/KFOmCnqEu92Fr1Mu4mxP.ttf>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/roboto/v20/KFOlCnqEu92Fr1MmWUlfBBc9.ttf>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/roboto/v20/KFOlCnqEu92Fr1MmYUtfBBc9.ttf>; rel=preload; as=font; crossorigin,<https://fonts.googleapis.com>; rel=preconnect; crossorigin,<https://fonts.gstatic.com>; rel=preconnect; crossorigin,<https://img1.wsimg.com>; rel=preconnect; crossorigin
cache-control: max-age=30
content-security-policy: frame-ancestors 'self'
content-type: text/html;charset=utf-8
vary: Accept-Encoding
content-encoding: gzip
server: DPS/1.8.1
x-siteid: 1000
set-cookie: dps_site_id=1000; path=/; secure
etag: 4a2471d5d9bb26225b7762512ca1b978
date: Tue, 14 Apr 2020 11:03:29 GMT

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
TXT NETORGFT5106789.onmicrosoft.com 3600
TXT v=spf1 include:spf.protection.outlook.com -all 3600
MX kleansweepcleaningservices-info.mail.protection.outlook.com 3600
SOA 3600
Mname ns55.domaincontrol.com
Rname dns.jomax.net
Serial Number 2019062502
Refresh 28800
Retry 7200
Expire 604800
Minimum TTL 600
A 50.63.202.35 595
NS ns55.domaincontrol.com 3595
NS ns56.domaincontrol.com 3595