Evinterneti-abonelikkampanyasitarifelerii.site - Info evinterneti-abonelikkampanyasitarifelerii.site

Domain Summary

What IP addresses does Evinterneti-abonelikkampanyasitarifelerii.site resolve to?

• Evinterneti-abonelikkampanyasitarifelerii.site resolves to the IP addresses

Where are Evinterneti-abonelikkampanyasitarifelerii.site servers located in?

• Evinterneti-abonelikkampanyasitarifelerii.site has servers located in Germany.

About - evinterneti-abonelikkampanyasitarifelerii.site

What technologies does evinterneti-abonelikkampanyasitarifelerii.site use?

Web Servers
Reverse proxies
OWL Carousel
OWL Carousel
Issue Trackers
Live Chat
JavaScript Libraries

evinterneti-abonelikkampanyasitarifelerii.site Profile

Description: Türktelekom İnternet Başvurusu
Keywords: Türktelekom İnternet Başvurusu
Last update was 26 days ago
This can take up to 60 seconds. Please wait...

*HypeStat.com is not linking to, promoting or affiliated with in any way. Only publicly available statistics data are displayed.

evinterneti-abonelikkampanyasitarifelerii.site Traffic Summary

Is this your site?
Verify your site's metrics.
Daily Unique Visitors:
Monthly Visits:
Pages per Visitor:
Daily Pageviews:
Alexa Rank:
Currently Not Available visit alexa
Alexa Reach:
n/a   (of global internet users)
Avg. visit duration:
Bounce rate:
*All traffic values are estimates only.

Competitive Data

(Rank based on keywords, cost and organic traffic)
Organic Keywords:
(Number of keywords in top 20 Google SERP)
Organic Traffic:
(Number of visitors coming from top 20 search results)
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
Adwords Keywords:
(Keywords a website is buying in Google AdWords for ads that appear in paid search results)
Adwords Traffic:
(Number of visitors brought to the website via paid search results)
Adwords Cost:
(Estimated budget spent for buying keywords in Google AdWords for ads that appear in paid search results - monthly estimation)

+ Ad Experience Report

Summary of the ad experience rating of a site for a specific platform.

Desktop summary

Root domain:
(The Ad Standard region to which this site has been assigned.)
Ad filtering:
(Chrome is not filtering ads on your site.)
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Mobile summary

(The Ad Standard region to which this site has been assigned.)
Ad filtering:
(Chrome is not filtering ads on your site.)
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

+ Abusive Experience Report

Root domain:
(Chrome is not preventing your site from opening new windows or tabs.)
(The status of the site reviewed for the abusive experiences.)
Not reviewed

+ Where is evinterneti-abonelikkampanyasitarifelerii.site hosted?

+ Does evinterneti-abonelikkampanyasitarifelerii.site use compression?

evinterneti-abonelikkampanyasitarifelerii.site use gzip compression.
Original size: 20.04 KB
Compressed size: 4.16 KB
File reduced by: 15.88 KB (79%)

+ Google Safe Browsing

This site is not currently listed as suspicious

+ SSL Checker - SSL Certificate Verify

evinterneti-abonelikkampanyasitarifelerii.site supports HTTPS
Verifying SSL Support. Please wait...

+ Verify HTTP/2 Support

evinterneti-abonelikkampanyasitarifelerii.site supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...

+ Http Header

Server: nginx-reuseport/1.21.1
Date: Sun, 26 Sep 2021 19:07:02 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=30
Vary: Accept-Encoding
Last-Modified: Thu, 26 Aug 2021 15:34:06 GMT
ETag: W/"8ca2-5ca7818f05509"
Content-Encoding: gzip
Server: nginx
Date: Sun, 26 Sep 2021 19:07:04 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://evinterneti-abonelikkampanyasitarifelerii.site/

HTTP/2 200 
server: nginx
date: Sun, 26 Sep 2021 19:07:04 GMT
content-type: text/html
last-modified: Mon, 02 Aug 2021 15:43:38 GMT
vary: Accept-Encoding
etag: W/"610812aa-502a"
content-encoding: gzip

+ DNS Lookup

Type Ip Target TTL
A 3600
SOA 3600
Mname ns84.kebirhost.com
Rname hostmaster.evinterneti-abonelikkampanyasitarifelerii.site
Serial Number 2021090201
Refresh 3600
Retry 3600
Expire 1209600
Minimum TTL 0
TXT 3600
MX mail.evinterneti-abonelikkampanyasitarifelerii.site 3600
NS ns85.kebirhost.com 3598
NS ns84.kebirhost.com 3598
Last update was 26 days ago
This can take up to 60 seconds. Please wait...

*HypeStat.com is not linking to, promoting or affiliated with in any way. Only publicly available statistics data are displayed.
We are using the world's No. 1 Marketing Tool to grow our website. Activate your FREE trial today!


Install HypeStat extension in your browser to see statistics and technologies used with one click.

Hide/Remove your site data

• Use Show/Hide ESTIMATED data form to hide (Website worth, Daily ads revenue, Daily Visits, Daily Pageviews)
• Use Show/Hide WHOIS data form to hide whois data
• Use Remove form to remove all data
• If you have any problem with REMOVE/HIDE your data just drop an email at support (at) hypestat.com and we will remove/hide your site data manualy.
Make custom Widget for your website
Get the code now!
evinterneti-abonelikkampanyasitarifelerii.site widget