emarylandmarketplaceadvantage.com Emarylandmarketplaceadvantage.com

   

Domain Summary

What is the traffic rank for Emarylandmarketplaceadvantage.com?

• Emarylandmarketplaceadvantage.com ranks #7,384,976 globally on HypeStat.

What IP addresses does Emarylandmarketplaceadvantage.com resolve to?

• Emarylandmarketplaceadvantage.com resolves to the IP addresses 199.59.242.153.

Where are Emarylandmarketplaceadvantage.com servers located in?

• Emarylandmarketplaceadvantage.com has servers located in United States.

emarylandmarketplaceadvantage.com Profile

What technologies does emarylandmarketplaceadvantage.com use?

These are the technologies used at emarylandmarketplaceadvantage.com. emarylandmarketplaceadvantage.com has a total of 3 technologies installed in 3 different categories.

emarylandmarketplaceadvantage.com Traffic Analysis

Emarylandmarketplaceadvantage.com is ranked #7,384,976 in the world.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
7,384,976
*All traffic values are estimates only.
Last update was 1298 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with emarylandmarketplaceadvantage.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  emarylandmarketplaceadvantage.com
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
emarylandmarketplaceadvantage.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
emarylandmarketplaceadvantage.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
emarylandmarketplaceadvantage.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is emarylandmarketplaceadvantage.com hosted?

Emarylandmarketplaceadvantage.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
199.59.242.153
ASN:
AS395082 
ISP:
Bodis, LLC 
Server Location:

United States, US
 

Other sites hosted on 199.59.242.153

Does emarylandmarketplaceadvantage.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience.
emarylandmarketplaceadvantage.com use br compression.
Original size: 3.93 KB
Compressed size: 3.93 KB
File reduced by: n/a

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. emarylandmarketplaceadvantage.com does not support HTTPS.
 emarylandmarketplaceadvantage.com does not support HTTPS
     
Verifying SSL Support. Please wait...

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 emarylandmarketplaceadvantage.com does not support HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
MX mx76.m2bp.com 3600
MX mx76.mb1p.com 3600
SOA 3600
Mname ns1.bodis.com
Rname dnsadmin.bodis.com
Serial Number 2017062202
Refresh 10800
Retry 3600
Expire 1209600
Minimum TTL 3600
A 199.59.242.153 3600
NS ns2.bodis.com 3599
NS ns1.bodis.com 3599