drkatiailievafamilypracticellc.com Drkatiailievafamilypracticellc.com

   

Domain Summary

What is the traffic rank for Drkatiailievafamilypracticellc.com?

• Drkatiailievafamilypracticellc.com ranks #6,689,192 globally on HypeStat.

What IP addresses does Drkatiailievafamilypracticellc.com resolve to?

• Drkatiailievafamilypracticellc.com resolves to the IP addresses 216.239.36.21.

Where are Drkatiailievafamilypracticellc.com servers located in?

• Drkatiailievafamilypracticellc.com has servers located in Mountain View, California, 94035, United States.

drkatiailievafamilypracticellc.com Profile

What technologies does drkatiailievafamilypracticellc.com use?

These are the technologies used at drkatiailievafamilypracticellc.com. drkatiailievafamilypracticellc.com has a total of 5 technologies installed in 6 different categories.

drkatiailievafamilypracticellc.com Traffic Analysis

Drkatiailievafamilypracticellc.com is ranked #6,689,192 in the world.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
6,689,192
*All traffic values are estimates only.
Last update was 1657 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with drkatiailievafamilypracticellc.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  drkatiailievafamilypracticellc.com
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
drkatiailievafamilypracticellc.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
drkatiailievafamilypracticellc.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
drkatiailievafamilypracticellc.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is drkatiailievafamilypracticellc.com hosted?

Drkatiailievafamilypracticellc.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
216.239.36.21
ASN:
AS15169 
ISP:
Google LLC 
Server Location:
Mountain View
California, CA
94035
United States, US
 

Other sites hosted on 216.239.36.21

Does drkatiailievafamilypracticellc.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience.
drkatiailievafamilypracticellc.com use gzip compression.
Original size: 1.52 KB
Compressed size: 1.52 KB
File reduced by: n/a

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. drkatiailievafamilypracticellc.com does not support HTTPS.
 drkatiailievafamilypracticellc.com does not support HTTPS
     
Verifying SSL Support. Please wait...

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 drkatiailievafamilypracticellc.com does not support HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
Date: Sat, 30 Jan 2021 14:57:30 GMT
Content-Type: text/html; charset=UTF-8
Server: ghs
Content-Length: 1561
X-XSS-Protection: 0
X-Frame-Options: SAMEORIGIN

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
TXT google-site-verification=25rdCs-HvEnYSzl-bmpBrmb9sJJtdLPgY0W4wBN0yuo 600
TXT v=spf1 include:_spf.google.com ?all 600
MX aspmx4.googlemail.com 600
MX aspmx5.googlemail.com 600
MX aspmx.l.google.com 600
MX alt3.aspmx.l.google.com 600
MX alt4.aspmx.l.google.com 600
MX alt1.aspmx.l.google.com 600
MX alt2.aspmx.l.google.com 600
MX aspmx2.googlemail.com 600
MX aspmx3.googlemail.com 600
SOA 3600
Mname ns05.domaincontrol.com
Rname dns.jomax.net
Serial Number 2020061806
Refresh 28800
Retry 7200
Expire 604800
Minimum TTL 600
A 216.239.32.21 566
A 216.239.34.21 566
A 216.239.36.21 566
A 216.239.38.21 566
NS ns05.domaincontrol.com 3566
NS ns06.domaincontrol.com 3566

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 18, 2020 and will expire on August 15, 2025 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on August 15, 2025.
Domain Created:
2020-06-18
Domain Age:
5 years 1 months 27 days
WhoIs:
 

whois lookup at whois.godaddy.com...Domain Name: drkatiailievafamilypracticellc.com
Registry Domain ID: 2539605334_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-06-18T15:53:40Z
Creation Date: 2020-06-18T15:53:39Z
Registrar Registration Expiration Date: 2021-06-18T15:53:39Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: email
Registrar Abuse Contact Phone: +1.4806242505
Reseller: Google Workspace
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 14455 N. Hayden Road
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext: 
Registrant Fax: +1.4806242598
Registrant Fax Ext: 
Registrant Email: email
Registry Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 14455 N. Hayden Road
Admin City: Scottsdale
Admin State/Province: Arizona
Admin Postal Code: 85260
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext: 
Admin Fax: +1.4806242598
Admin Fax Ext: 
Admin Email: email
Registry Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 14455 N. Hayden Road
Tech City: Scottsdale
Tech State/Province: Arizona
Tech Postal Code: 85260
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext: 
Tech Fax: +1.4806242598
Tech Fax Ext: 
Tech Email: email
Name Server: NS05.DOMAINCONTROL.COM
Name Server: NS06.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-01-30T14:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

TERMS OF USE: The data contained in this registrar's Whois database, while believed by the 
registrar to be reliable, is provided "as is" with no guarantee or warranties regarding its
accuracy. This information is provided for the sole purpose of assisting you in obtaining 
information about domain name registration records. Any use of this data for any other purpose 
is expressly forbidden without the prior written permission of this registrar. By submitting 
an inquiry, you agree to these terms and limitations of warranty. In particular, you agree not 
to use this data to allow, enable, or otherwise support the dissemination or collection of this 
data, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone, 
postal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations 
of any kind, including spam. You further agree not to use this data to enable high volume, automated 
or robotic electronic processes designed to collect or compile this data for any purpose, including 
mining this data for your own personal or commercial purposes. Failure to comply with these terms 
may result in termination of access to the Whois database. These terms may be subject to modification 
at any time without notice.whois lookup at whois.crsnic.net...Domain Name: DRKATIAILIEVAFAMILYPRACTICELLC.COM
   Registry Domain ID: 2539605334_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.godaddy.com
   Registrar URL: http://www.godaddy.com
   Updated Date: 2020-06-18T15:53:40Z
   Creation Date: 2020-06-18T15:53:39Z
   Registry Expiry Date: 2021-06-18T15:53:39Z
   Registrar: GoDaddy.com, LLC
   Registrar IANA ID: 146
   Registrar Abuse Contact Email: email
   Registrar Abuse Contact Phone: 480-624-2505
   Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
   Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
   Name Server: NS05.DOMAINCONTROL.COM
   Name Server: NS06.DOMAINCONTROL.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2021-01-30T14:57:49Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar.  Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability.  VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.