Dolllysfarmcaravancampsite.wales
Dol Llys Farm Caravan and Camping Powys Campsite Llanidloes Mid WalesDomain Summary
What is the traffic rank for Dolllysfarmcaravancampsite.wales?
• Dolllysfarmcaravancampsite.wales ranks #8,890,230 globally on HypeStat.
What IP addresses does Dolllysfarmcaravancampsite.wales resolve to?
• Dolllysfarmcaravancampsite.wales resolves to the IP addresses 77.68.64.42.
Where are Dolllysfarmcaravancampsite.wales servers located in?
• Dolllysfarmcaravancampsite.wales has servers located in Wrexham, Wrexham, LL13, United Kingdom.
dolllysfarmcaravancampsite.wales Profile
Title:
Dol Llys Farm Caravan and Camping Powys Campsite Llanidloes Mid Wales
Description:Dol Llys Farm Caravan and Campsite in Llanidloes a family run Camping and Touring Caravan park established over 25 years ago. The Powys based campsite is nestled in the rolling Mid Wales countryside ideal for West Wales Holidays
Tags:
What technologies does dolllysfarmcaravancampsite.wales use?
These are the technologies used at dolllysfarmcaravancampsite.wales. dolllysfarmcaravancampsite.wales has a total of 7 technologies installed in 7 different categories.dolllysfarmcaravancampsite.wales Traffic Analysis
Dolllysfarmcaravancampsite.wales is ranked #8,890,230 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 8,890,230
Last update was 250 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with dolllysfarmcaravancampsite.wales in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- dolllysfarmcaravancampsite.wales
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- dolllysfarmcaravancampsite.wales
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- dolllysfarmcaravancampsite.wales
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- dolllysfarmcaravancampsite.wales
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is dolllysfarmcaravancampsite.wales hosted? ▼
Dolllysfarmcaravancampsite.wales may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 77.68.64.42
- ASN:
- AS8560
- ISP:
- 1&1 Internet SE
- Server Location:
- Wrexham
Wrexham, WRX
LL13
United Kingdom, GB
Other sites hosted on 77.68.64.42
How fast does dolllysfarmcaravancampsite.wales load? ▼
The average loading time of dolllysfarmcaravancampsite.wales is 565 ms.- Average Load Time:
- 565 ms
Does dolllysfarmcaravancampsite.wales use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on dolllysfarmcaravancampsite.wales are reduced by 59%.
dolllysfarmcaravancampsite.wales use gzip compression.
Original size: 17.35 KB
Compressed size: 7.05 KB
File reduced by: 10.31 KB (59%)
Compressed size: 7.05 KB
File reduced by: 10.31 KB (59%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. dolllysfarmcaravancampsite.wales supports HTTPS. dolllysfarmcaravancampsite.wales supports HTTPS
Verifying SSL Support. Please wait...
Common Name: dolllysfarmcaravancampsite.wales
Organization:
Location:
Issuer: Encryption Everywhere DV TLS CA - G1
Valid from: Jan 14 00:00:00 2023 GMT
Valid until: Jan 13 23:59:59 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: Encryption Everywhere DV TLS CA - G1
Valid from: Jan 14 00:00:00 2023 GMT
Valid until: Jan 13 23:59:59 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: Encryption Everywhere DV TLS CA - G1
Organization: DigiCert Inc, OU = www.digicert.com
Location: US
Issuer: DigiCert Global Root CA
Valid from: Nov 27 12:46:10 2017 GMT
Valid until: Nov 27 12:46:10 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: DigiCert Inc, OU = www.digicert.com
Location: US
Issuer: DigiCert Global Root CA
Valid from: Nov 27 12:46:10 2017 GMT
Valid until: Nov 27 12:46:10 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. dolllysfarmcaravancampsite.wales supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.server: nginx/1.21.6
date: Mon, 18 Sep 2023 19:09:31 GMT
content-type: text/html; charset=utf-8
content-length: 7215
cache-control: private
content-encoding: gzip
vary: Accept-Encoding
x-aspnet-version: 4.0.30319
x-powered-by: ASP.NET
strict-transport-security: max-age=15768000
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 3600 | ||
Mname | ns1.livedns.co.uk | ||
Rname | admin.dolllysfarmcaravancampsite.wales | ||
Serial Number | 1673627888 | ||
Refresh | 10800 | ||
Retry | 3600 | ||
Expire | 604800 | ||
Minimum TTL | 3600 | ||
TXT | 3600 | ||
MX | 3600 | ||
A | 77.68.64.42 | 3595 | |
NS | 3600 | ||
NS | 3600 | ||
NS | 3600 |