Daveramseysfinancialwellness.com
SmartDollar - Ramsey
Domain Summary
What IP addresses does Daveramseysfinancialwellness.com resolve to?
• Daveramseysfinancialwellness.com resolves to the IP addresses 15.197.225.128.
Where are Daveramseysfinancialwellness.com servers located in?
• Daveramseysfinancialwellness.com has servers located in United States.
daveramseysfinancialwellness.com Profile
Title:SmartDollar - Ramsey
Description:SmartDollar is an employee financial wellness program from Dave Ramsey. Your employees learn how to budget, pay off debt, save and retire with confidence.
What technologies does daveramseysfinancialwellness.com use?
These are the technologies used at daveramseysfinancialwellness.com. daveramseysfinancialwellness.com has a total of 13 technologies installed in 10 different categories.daveramseysfinancialwellness.com Traffic Analysis
There's no enough data about daveramseysfinancialwellness.com traffic.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- n/a
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- daveramseysfinancialwellness.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Backlinks Report ▼
Daveramseysfinancialwellness.com has a total of 234 backlinks from 139 referring domains and most of them comes from Singapore.- Total Backlinks:
- 234
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 139
- Referring IPs:
- 78
- Authority Domain Score:
- 2
Backlinks by country
- Country
- Domains
- Singapore 70
- Moldova 13
- France 4
- United States 2
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 64
- .in
- 13
- .org
- 6
- .edu
- 0
- .gov
- 0
Last update was 26 mins ago
This can take up to 60 seconds. Please wait...
Update will be available in 24 hours
This can take up to 60 seconds. Please wait...
Update will be available in 24 hours
*HypeStat.com is not promoting or affiliated with daveramseysfinancialwellness.com in any way. Only publicly available statistics data are displayed.
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- daveramseysfinancialwellness.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- daveramseysfinancialwellness.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- daveramseysfinancialwellness.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is daveramseysfinancialwellness.com hosted? ▼
Daveramseysfinancialwellness.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 15.197.225.128
- ASN:
- AS16509
- ISP:
- Amazon.com, Inc.
- Server Location:
United States, US
Other sites hosted on 15.197.225.128
How fast does daveramseysfinancialwellness.com load? ▼
The average loading time of daveramseysfinancialwellness.com is 268 ms.- Average Load Time:
- 268 ms
Does daveramseysfinancialwellness.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on daveramseysfinancialwellness.com are reduced by 87%.
daveramseysfinancialwellness.com use gzip compression.
Original size: 554.75 KB
Compressed size: 69.86 KB
File reduced by: 484.89 KB (87%)
Compressed size: 69.86 KB
File reduced by: 484.89 KB (87%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. daveramseysfinancialwellness.com supports HTTPS. daveramseysfinancialwellness.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: ramseysolutions.com
Organization:
Location:
Issuer: Amazon RSA 2048 M01
Valid from: Sep 26 00:00:00 2025 GMT
Valid until: Oct 25 23:59:59 2026 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: Amazon RSA 2048 M01
Valid from: Sep 26 00:00:00 2025 GMT
Valid until: Oct 25 23:59:59 2026 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: Amazon RSA 2048 M01
Organization: Amazon
Location: US
Issuer: Amazon Root CA 1
Valid from: Aug 23 22:21:28 2022 GMT
Valid until: Aug 23 22:21:28 2030 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Amazon
Location: US
Issuer: Amazon Root CA 1
Valid from: Aug 23 22:21:28 2022 GMT
Valid until: Aug 23 22:21:28 2030 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: Amazon Root CA 1
Organization: Amazon
Location: US
Issuer: Starfield Services Root Certificate Authority - G2
Valid from: May 25 12:00:00 2015 GMT
Valid until: Dec 31 01:00:00 2037 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Amazon
Location: US
Issuer: Starfield Services Root Certificate Authority - G2
Valid from: May 25 12:00:00 2015 GMT
Valid until: Dec 31 01:00:00 2037 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. daveramseysfinancialwellness.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.content-type: text/html; charset=utf-8
date: Wed, 26 Aug 2026 03:49:32 GMT
location: https://www.ramseysolutions.com/corporate-wellness/smartdollar
server: ip-100-74-4-79.eu-west-2.compute.internal
vary: Accept-Encoding
x-request-id: c2627338-d10a-4d7a-8b40-7494d157e184
content-length: 97
HTTP/2 200
content-type: text/html;charset=UTF-8
content-length: 71539
date: Wed, 26 Aug 2026 03:43:46 GMT
x-frame-options: SAMEORIGIN
server: Apache
strict-transport-security: max-age=31536000; includeSubDomains
cache-control: s-maxage=1800, stale-while-revalidate=604800, stale-if-error=604800
cache-control: max-age=1800, public
expires: Wed, 26 Aug 2026 04:13:46 GMT
content-encoding: gzip
vary: Accept-Encoding
via: 1.1 b3fce8903671f8346e7a6a138d2d4610.cloudfront.net (CloudFront)
age: 346
x-cache: Hit from cloudfront
x-amz-cf-pop: FRA60-P1
x-amz-cf-id: haK4I1uF2liKvrifOQgQ1tQcxk78quySHHt4t4SueaaIqg-LY78eLw==
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| A | 15.197.225.128 | 3600 | |
| A | 3.33.251.168 | 3600 | |
| NS | 3600 | ||
| NS | 3600 | ||
| SOA | 600 | ||
| Mname | ns47.domaincontrol.com | ||
| Rname | dns.jomax.net | ||
| Serial Number | 2026060403 | ||
| Refresh | 28800 | ||
| Retry | 7200 | ||
| Expire | 604800 | ||
| Minimum TTL | 600 | ||
| MX | 3600 | ||
| MX | 3600 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on April 28, 2010 and will expire on April 28, 2027 if not renewed. This website is now assigned through the registrar GoDaddy.com, LLC. The WHOIS data for this website's domain was last updated on October 2, 2025.- Domain Created:
- 2010-04-28
- Domain Expires:
- 2027-04-28
- Domain Updated:
- 2025-10-02
- Domain Age:
- 16 years 3 months 28 days
- Domain Registrar:
- GoDaddy.com, LLC
- WhoIs:
Domain Name: DAVERAMSEYSFINANCIALWELLNESS.COM Registry Domain ID: 1594784526_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2025-10-02T17:44:09Z Creation Date: 2010-04-28T20:58:05Z Registry Expiry Date: 2027-04-28T20:58:05Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS47.DOMAINCONTROL.COM Name Server: NS48.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2026-08-26T03:49:48Z