cedarrapidscriminalattorney.net Cedarrapidscriminalattorney.net

   
Home - Cory Goldensoph, Criminal Lawyer in Cedar Rapids, Iowa

Domain Summary

What IP addresses does Cedarrapidscriminalattorney.net resolve to?

• Cedarrapidscriminalattorney.net resolves to the IP addresses 15.197.225.128.

Where are Cedarrapidscriminalattorney.net servers located in?

• Cedarrapidscriminalattorney.net has servers located in United States.

cedarrapidscriminalattorney.net Profile

Title:Home - Cory Goldensoph, Criminal Lawyer in Cedar Rapids, Iowa Description:specializing as a criminal defense attorney and owi lawyer in eastern iowa including cedar rapids, waterloo, iowa city. check out the results he gets for his clients. his record speaks for itself.

What technologies does cedarrapidscriminalattorney.net use?

These are the technologies used at cedarrapidscriminalattorney.net. cedarrapidscriminalattorney.net has a total of 11 technologies installed in 11 different categories.

cedarrapidscriminalattorney.net Traffic Analysis

There's no enough data about cedarrapidscriminalattorney.net traffic.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
n/a
*All traffic values are estimates only.
Last update was 241 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with cedarrapidscriminalattorney.net in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  cedarrapidscriminalattorney.net
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
cedarrapidscriminalattorney.net
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
cedarrapidscriminalattorney.net
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
cedarrapidscriminalattorney.net
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is cedarrapidscriminalattorney.net hosted?

Cedarrapidscriminalattorney.net may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
15.197.225.128
ASN:
AS16509 
ISP:
Amazon.com, Inc. 
Server Location:

United States, US
 

Other sites hosted on 15.197.225.128

There are no other sites hosted on this IP

How fast does cedarrapidscriminalattorney.net load?

The average loading time of cedarrapidscriminalattorney.net is 307 ms. The Desktop speed index is 92 and mobile speed index is 67.
Average Load Time:
307 ms

Page Speed (Google PageSpeed Insights) - Desktop

92
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Lab Data

Total Blocking Time 0 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Speed Index 1.1 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Time to Interactive 2.0 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Preload Largest Contentful Paint image  
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
First Meaningful Paint  
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Largest Contentful Paint 1.3 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
First Contentful Paint 1.1 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Lazy load third-party resources with facades  
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Max Potential First Input Delay 60 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Largest Contentful Paint image was not lazily loaded  
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading

Page Speed (Google PageSpeed Insights) - Mobile

67
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s)Largest Contentful Paint (LCP) 0%

Lab Data

Total Blocking Time 10 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Lazy load third-party resources with facades  
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Speed Index 3.8 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Time to Interactive 6.5 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
First Meaningful Paint  
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Largest Contentful Paint image was not lazily loaded  
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Preload Largest Contentful Paint image  
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
Largest Contentful Paint 5.3 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
First Contentful Paint 3.8 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Max Potential First Input Delay 60 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric

Does cedarrapidscriminalattorney.net use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on cedarrapidscriminalattorney.net are reduced by 79%.
cedarrapidscriminalattorney.net use br compression.
Original size: 96.79 KB
Compressed size: 19.76 KB
File reduced by: 77.03 KB (79%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

MyWot.com Reputation Ratings

MyWOT (short for "My Web of Trust") is a web-based reputation and rating service that provides users with information about the trustworthiness and safety of websites.
Status:
  NOT_SAFE

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. cedarrapidscriminalattorney.net supports HTTPS.
 cedarrapidscriminalattorney.net supports HTTPS
     
Verifying SSL Support. Please wait...
Common Name: criminaldefenselawyercedarrapids.com
Organization:
Location:
Issuer: WE1
Valid from: Nov 8 10:24:50 2024 GMT
Valid until: Feb 6 11:24:48 2025 GMT
Authority: CA:FALSE
Keysize:
Common Name: WE1
Organization: Google Trust Services
Location: US
Issuer: GTS Root R4
Valid from: Dec 13 09:00:00 2023 GMT
Valid until: Feb 20 14:00:00 2029 GMT
Authority: CA:TRUE
Keysize:
Common Name: GTS Root R4
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Nov 15 03:43:21 2023 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize:

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 cedarrapidscriminalattorney.net supports HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
Content-Length: 79
Content-Type: text/html; charset=utf-8
Date: Wed, 18 Dec 2024 15:17:01 GMT
Location: http://criminaldefenselawyercedarrapids.com/
Server: ip-10-123-124-188.ec2.internal
Vary: Accept-Encoding
X-Request-Id: b9a21d9c-1468-425a-acb2-d58b2ee5e0b6
Connection: close

HTTP/1.1 308 Permanent Redirect
Date: Wed, 18 Dec 2024 15:17:01 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
location: https://criminaldefenselawyercedarrapids.com/
x-backend: varnish_ssl
Strict-Transport-Security: max-age=31536000; includeSubDomains
CF-Cache-Status: MISS
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 8f401e0affb96345-ORD
alt-svc: h3=":443"; ma=86400

HTTP/2 200 
date: Wed, 18 Dec 2024 15:17:01 GMT
content-type: text/html; charset=UTF-8
content-security-policy: upgrade-insecure-requests
strict-transport-security: max-age=300
strict-transport-security: max-age=31536000; includeSubDomains
vary: Accept-Encoding, User-Agent
x-cache: cached
x-cache-hit: HIT
x-cacheable: YES:Forced
x-cacheproxy-retries: 0/2
x-content-type-options: nosniff
x-fawn-proc-count: 1,1,24
x-php-version: 8.0
x-xss-protection: 1; mode=block
x-backend: varnish_ssl
last-modified: Thu, 12 Dec 2024 21:25:03 GMT
cf-cache-status: HIT
age: 487278
expires: Sat, 18 Jan 2025 15:17:01 GMT
cache-control: public, max-age=2678400
server: cloudflare
cf-ray: 8f401e0bff3be98e-ORD
content-encoding: br
alt-svc: h3=":443"; ma=86400

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
TXT v=spf1 a mx ptr include:secureserver.net ~all 3600
MX mail.cedarrapidscriminalattorney.net 3600
SOA 3600
Mname ns25.domaincontrol.com
Rname dns.jomax.net
Serial Number 2024062600
Refresh 28800
Retry 7200
Expire 604800
Minimum TTL 86400
A 3.33.251.168 3305
A 15.197.225.128 3305
NS ns25.domaincontrol.com 3600
NS ns26.domaincontrol.com 3600

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on December 20, 2011 and will expire on December 20, 2024 if not renewed. This website is now assigned through the registrar GoDaddy.com, LLC. The WHOIS data for this website's domain was last updated on December 21, 2022.
Domain Created:
2011-12-20
Domain Expires:
2024-12-20
Domain Updated:
2022-12-21
Domain Age:
13 years 7 months 28 days
Domain Registrar:
GoDaddy.com, LLC
WhoIs:
 

   Domain Name: CEDARRAPIDSCRIMINALATTORNEY.NET
   Registry Domain ID: 1693041752_DOMAIN_NET-VRSN
   Registrar WHOIS Server: whois.godaddy.com
   Registrar URL: http://www.godaddy.com
   Updated Date: 2022-12-21T16:35:41Z
   Creation Date: 2011-12-20T15:37:52Z
   Registry Expiry Date: 2024-12-20T15:37:52Z
   Registrar: GoDaddy.com, LLC
   Registrar IANA ID: 146
   Registrar Abuse Contact Email: email
   Registrar Abuse Contact Phone: 480-624-2505
   Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
   Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
   Name Server: NS25.DOMAINCONTROL.COM
   Name Server: NS26.DOMAINCONTROL.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2024-12-18T15:17:45Z