apluschimneysweepfireplacerepair.com Apluschimneysweepfireplacerepair.com

   
Chimney Sweep Sacramento | A+ Chimney Cleaning & Repair

Domain Summary

What IP addresses does Apluschimneysweepfireplacerepair.com resolve to?

• Apluschimneysweepfireplacerepair.com resolves to the IP addresses 2a02:4780:b:1519::1367:7fa7:10, 77.37.90.194.

Where are Apluschimneysweepfireplacerepair.com servers located in?

• Apluschimneysweepfireplacerepair.com has servers located in Phoenix, Arizona, 85036, United States.

apluschimneysweepfireplacerepair.com Profile

Title:Chimney Sweep Sacramento | A+ Chimney Cleaning & Repair Description:Top Chimney Sweep Sacramento service for cleaning, inspection, and repairs. Keep your chimney safe with A+ Chimney Repair. Schedule now!

What technologies does apluschimneysweepfireplacerepair.com use?

These are the technologies used at apluschimneysweepfireplacerepair.com. apluschimneysweepfireplacerepair.com has a total of 15 technologies installed in 14 different categories.

apluschimneysweepfireplacerepair.com Traffic Analysis

There's no enough data about apluschimneysweepfireplacerepair.com traffic.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
n/a
SEMrush Rank:
4,521,637
*All traffic values are estimates only.
Last update was 76 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with apluschimneysweepfireplacerepair.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  apluschimneysweepfireplacerepair.com
Rank:
(Rank based on keywords, cost and organic traffic)
  4,521,637
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  39
Organic Traffic:
(Number of visitors coming from top 20 search results)
  61
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $512.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
apluschimneysweepfireplacerepair.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
apluschimneysweepfireplacerepair.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
apluschimneysweepfireplacerepair.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is apluschimneysweepfireplacerepair.com hosted?

Apluschimneysweepfireplacerepair.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
2a02:4780:b:1519::1367:7fa7:10, 77.37.90.194
ASN:
AS47583 
ISP:
Hostinger International Limited 
Server Location:
Phoenix
Arizona, AZ
85036
United States, US
 

Other sites hosted on 77.37.90.194

How fast does apluschimneysweepfireplacerepair.com load?

The average loading time of apluschimneysweepfireplacerepair.com is 870 ms. The Desktop speed index is 98 and mobile speed index is 0.
Average Load Time:
870 ms

Page Speed (Google PageSpeed Insights) - Desktop

98
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Lab Data

Preload Largest Contentful Paint image  
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
Max Potential First Input Delay 50 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Lazy load third-party resources with facades  
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Time to Interactive 0.5 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
INP breakdown  
Start investigating with the longest subpart. To reduce processing duration, , often JS. Delays can be minimized optimize the main-thread costs
Speed Index 1.6 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
First Contentful Paint 0.4 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Meaningful Paint  
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Largest Contentful Paint image was not lazily loaded  
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Total Blocking Time 0 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Largest Contentful Paint 0.5 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
LCP request discovery  
Optimize LCP by making the LCP image from the HTML immediately, and discoverable avoiding lazy-loading

Does apluschimneysweepfireplacerepair.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on apluschimneysweepfireplacerepair.com are reduced by 79%.
apluschimneysweepfireplacerepair.com use gzip compression.
Original size: 218.75 KB
Compressed size: 45.16 KB
File reduced by: 173.59 KB (79%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

MyWot.com Reputation Ratings

MyWOT (short for "My Web of Trust") is a web-based reputation and rating service that provides users with information about the trustworthiness and safety of websites.
Status:
  NOT_SAFE

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. apluschimneysweepfireplacerepair.com supports HTTPS.
 apluschimneysweepfireplacerepair.com supports HTTPS
     
Verifying SSL Support. Please wait...
Common Name: apluschimneysweepfireplacerepair.com
Organization:
Location:
Issuer: ZeroSSL RSA Domain Secure Site CA
Valid from: Aug 19 00:00:00 2025 GMT
Valid until: Nov 17 23:59:59 2025 GMT
Authority: CA:FALSE
Keysize: 4096 Bits
Common Name: ZeroSSL RSA Domain Secure Site CA
Organization: ZeroSSL
Location: AT
Issuer: USERTrust RSA Certification Authority
Valid from: Jan 30 00:00:00 2020 GMT
Valid until: Jan 29 23:59:59 2030 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Common Name: USERTrust RSA Certification Authority
Organization: The USERTRUST Network
Location: Jersey City, New Jersey, US
Issuer: AAA Certificate Services
Valid from: Mar 12 00:00:00 2019 GMT
Valid until: Dec 31 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 apluschimneysweepfireplacerepair.com supports HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
x-powered-by: PHP/8.1.32
content-type: text/html; charset=utf-8
last-modified: Sat, 06 Sep 2025 11:47:09 GMT
cache-provider: CLOUDWAYS-CACHE-DE
content-security-policy: upgrade-insecure-requests
vary: Accept-Encoding
cache-control: public, max-age=0,s-maxage=2592000
expires: Sun, 07 Sep 2025 02:33:05 GMT
content-length: 46246
content-encoding: gzip
date: Sun, 07 Sep 2025 02:33:05 GMT
server: LiteSpeed
platform: hostinger
panel: hpanel
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
AAAA 2a02:4780:b:1519::1367:7fa7:10 1751